KEGG   Pan troglodytes (chimpanzee): 455243Help
Entry
455243            CDS       T01005                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: arachidonate 12-lipoxygenase, epidermal-type-like
  KO
K00458  arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00590  Arachidonic acid metabolism
ptr01100  Metabolic pathways
ptr01523  Antifolate resistance
ptr04726  Serotonergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    455243
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    455243
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    455243
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    455243
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     455243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT
Motif
Other DBs
NCBI-GeneID: 455243
NCBI-ProteinID: XP_016786879
Position
17
AA seq 662 aa AA seqDB search
MGKYTVRVATGDLLLAGSPNLVQLWLVGEHGEADLGKQLPPVWGKEAEFEIDVHLHLGRL
LMVKLRKHNVLLSLDWFCKWISVQGPGTQGEAFFPCYRWVQGHGIICLPEGTARTVSDDP
QSLFKKYREQELEERRKVYRWGSWKDGLILPIAGNRQPDLPRGERFLEDKDLDFNVSLAK
GLKDLAIQGTLDFINCVKRLEDFKKIFPHGKTVLAERVYDSWKNDAFFGYQFLNGANPML
LRRSSRLPACLVLPPGMEDLKTQLEKELQAGSLFEVDFSLLDGVKPNVIIFKQQYVAAPL
VMLKLQPVGGLLPMVIQLQPPXHGCPPPLLFLPSHPPMAWLLGKTWVRSSDFQLQQLQSH
LLRGHLIAEVIAVATMRSLPSLHPIYKLLIPHFRYTMAINTLAQSSLVSEWGIFDLVVST
GSGGHVDILQRAMACLTYHSLCPPDDLADRGLLDVKSTFYGXDAIRLWGIISRYVEGMVG
LFYKSDQAMKDDLELQAWCREMTETGLQRAQDQGFLISLESRAQLCHFVTMCIFTCTGQH
ASNHLGQLDWCSWIPNGPCTMQKPPPISKDVTEKDIVDLLPNLHQARMQKTFTKFLGRRQ
PVMVALGQHEEKYFSGPEPQAVLRQFQEELAAMDKEIEVRNAVLDLPCEYLRPSMVENSV
TI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacacggtccgcgtagccaccggggatttgctcctggcgggctctcccaac
ctggtgcagctgtggctggtgggcgagcacggggaggcagacctagggaagcagctgcca
ccggtgtggggaaaggaggcagagtttgagatcgacgtccacctgcacctggggcgcctc
ctgatggtgaagctgcgcaaacacaacgtgctgttgagtctcgactggttctgcaagtgg
atctcagtgcagggcccggggacccaaggcgaggcctttttcccctgctaccgctgggtg
cagggccacggaattatctgcctgcctgagggtactgcccggacggtgagtgatgacccc
cagagcctgtttaagaaatatcgggaacaggagctcgaggaaagaaggaaggtgtaccgg
tggggctcctggaaagatgggttaatcctgcctatagcagggaataggcaaccggacctt
cctaggggcgagcgattcctcgaggataaggatttagactttaatgtctccctagcaaaa
gggttgaaggacttggccattcaggggacactggatttcataaattgtgtgaaaaggctg
gaagatttcaaaaaaatattcccacatggaaagactgtcctggctgagcgggtttatgat
tcttggaagaatgatgccttctttgggtaccagtttctcaatggtgcaaaccccatgctc
ctgaggcgttcttcaaggctcccggcctgcctggtgctgcctccagggatggaagacttg
aagacccagctggagaaagaactccaggctggatctctgtttgaagtggacttctccttg
ctggatggagtcaagcctaatgtcatcatttttaagcagcaatacgtggcagcccctttg
gtcatgctgaagcttcagcctgttggaggactcttacccatggtcatccagctccagcca
ccttgacacggatgtcccccacctctgctctttctgccctcgcatccccccatggcctgg
ctcctgggcaagacctgggtccggagctctgatttccagctgcagcagttacagtcacat
ctgctgaggggacacttgattgctgaggttattgctgtggctacaatgagaagcttgcct
agcctccatcctatctacaagctcctgatcccccacttccgctacaccatggcgatcaac
acgctggcccagagtagtcttgtctccgaatggggaatttttgacctggtggtgagcact
ggtagtggaggccacgtggacattcttcagagagccatggcttgtttgacctatcattcc
ctctgtcctcctgatgacctggctgaccgtgggctcctggatgtgaaatctactttttat
ggctaagatgccatcaggctgtggggaatcatcagccggtacgtggaggggatggttggg
cttttctacaagagtgaccaagccatgaaggatgatctagagctgcaggcctggtgcaga
gagatgactgagactggactgcagagggcccaagaccaggggttcctcatctccttagag
tcccgggctcagctctgccactttgtcaccatgtgcatcttcacatgcacaggtcagcat
gcttctaaccacctgggccagctggactggtgctcctggatccctaatggcccatgcact
atgcagaagcccccgcccatctctaaggatgtgacagagaaggatatagtggacttactg
cccaatctccaccaggcacgtatgcaaaagaccttcacaaagttccttggcagacgccag
cctgtcatggtggccctggggcagcatgaggagaaatatttctctggccctgagccccaa
gctgtgctgagacaattccaggaggaactggctgccatggacaaggagattgaggtccgg
aatgcagtcctggacctgccctgtgagtaccttcgacccagcatggtagagaacagcgtg
accatctga

DBGET integrated database retrieval system