KEGG   Pan troglodytes (chimpanzee): 455723Help
Entry
455723            CDS       T01005                                 

Gene name
DOCK6
Definition
(RefSeq) dedicator of cytokinesis protein 6 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    455723 (DOCK6)
Membrane trafficking [BR:ptr04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    455723 (DOCK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 455723
NCBI-ProteinID: XP_016790535
Ensembl: ENSPTRG00000010493
VGNC: 2393
Position
19
AA seq 2126 aa AA seqDB search
MAASERRAFAHKINRTVAAEVRKQVSRERSGSPHSSRRCSSSLGVPLTEVVEPLDFEDIL
LSRPPDAEPGPLRDLVEFPADDLELLLQPRECRTTEPGIPKDEKLDAQVRAAVEMYIEDW
VIVHRRYQYLSAAYSPVTTETQRERQKGLPHQVFEQDASGDERSGPEDSVRKPLAGVTEG
NDSRRGSGSPEDTPRSSGASSIFDLRNLAADSLLPSLLERVVPEDVDRRNETLRRQHRPP
ALLTLYPAPDEDEAVERCSRPEPPREHFGQRILVKCLSLKFEIEIEPIFGILALYDVREK
KKISENFYFDLNSDSMKGLLRAHGTHPAISTLARSAIFSVTYPSPDIFLVIKLEKVLQQG
DISECCEPYMVLKEVDTAKNKEKLEKLRLAAEQFCTRLGRYRMPFAWTAVHLANIVSSAG
QLDRDSDSEGERRPAWTDRRRRGPQDRASSGDDACSFSGFRPATLTVTNFFKQEAERLSD
EDLFKFLADMRRPSSLLRRLRPVTAQLKIDISPAPENPHFCLSPELLHIKPYPDPRGRPT
KEILEFPAREVYAPHTSYRNLLYVYPHSLNFSSRQGSVRNLAVRVQYMTGEDPSQALPVI
FGKSSCSEFTREAFTPVVYHNKSPEFYEEFKLHLPACVTENHHLLFTFYHVSCQPRPGTA
LETPVGFTWIPLLQHGRLRTGPFCLPVSVDQPPPSYSVLTPDVALPGMRWVDGHKGVFSV
ELTAVSSVHPQDPYLDKFFTLVHVLEEGAFPFRLKDTVLSEGNVEQELRASLAALRLASP
EPLVAFSHHVLDKLVRLVIRPPIISGQIVNLGRGAFEAMAHVVSLVHRSLEAAQDARGHC
PQLAAYVHYAFRLPGTEPSLPDGAPPVTVQAATLARGSGRPASLYLARSKSISSSNPDLA
VAPGSVDDEVSRILASKGIDRSHSWVNSAYAPGGSKAVLRRAPPYCGADPRQAIDRTSSR
ASSYLEGSSSAPPATQLRPTVQKLLHEELALQWVVSSSAVREAILQHAWFFFQLMVKSMA
LHLLLGQRLDTPRKLRFPGRFLDDITALVGSVGLEVITRVHKDVELAEHLNASLAFFLSD
LLSLVDRGFVFSLVRAHYKQVATRLQSSPNPAALLTLRMEFTRILCSHEHYVTLNLPCCP
LSPPASPSPSVSSTTSQSSTFSSQAPDPKVTSMFELSGPFRQQHFLAGLLLTELALALEP
EAEGAFLLHKKAISAVHSLLCGHDTDPRYAEATVKARVAELYLPLLSIARDTLPRLHDFA
EGPGQRSRLASMLDSDTEGEGDIAGTINPSVAMAIAGGPLAPGSRASISQGPPTASRAGC
ALSAESSRTLLACVLWVLKNAEPALLQRWATDLTLPQLGRLLDLLYLCLAAFEYKGKKAF
ERINSLTFKKSLDMKARLEEAILGTIGARQEMVRRSRERSPFGNPENVRWRKSVTHWKQT
SDRVDKTKDEMEHEALVEGNLATEASLVVLDTLEIIVQTVMLSEARESVLGAVLKVVLYS
LGSAQSALFLQHGLATQRALVSKFPELLFEEDTELCADLCLRLLRHCGSRISTIRTHASA
SLYLLMRQNFEIGHNFARVKMQVTMSLSSLVGTTQNFSEEHLRRSLKTILTYAEEDMGLR
DSTFAEQVQDLMFNLHMILTDTVKMKEHQEDPEMLIDLMYRIARGYQGSPDLRLTWLQNM
AGKHAELGNHAEAAQCMVHAAALVAEYLALLEDHRHLPVGCVSFQNISSNVLEESAISDD
ILSPDEEGFCSGKHFTELGLVGLLEQAAGYFTMGGLYEAVNEVYKNLIPILEAHRDYKKL
AAVHGKLQEAFTKIMHQSSGWEPQRVFGTYFRVGFYGARFGDLDEQEFVYKEPSITKLAE
ISHRLEEFYTERFGDDVVEIIKDSNPVDKSKLDSQKAYIQITYVEPYFDTYELKDRVTYF
DRNYGLRTFLFCTPFTPDGRAHGELPEQHKRKTLLSTDHAFPYIKTRIRVCHREETVLTP
VEVAIEDMQKKTRELAFATEQDPPDAKMLQMVLQGSVGPTVNQGPLEVAQVFLAEIPEDP
KLFRHHNKLRLCFKDFCKKCEDALRKNKALIGPDQKEYHRELERNYCRLREALQPLLTQR
LPQLMAPTPPGLRNSLNRASFRKADL
NT seq 6381 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccgagcgccgcgccttcgcgcacaagatcaacaggacggtggccgcagag
gtgcggaagcaggtgtcccgggaacgcagtggctccccccactccagcaggcgctgcagc
agctccctgggggtcccactgactgaggttgtcgagcccctggactttgaggatatactt
ctgagccggccaccagatgctgagcccgggcccctcagggacctggtagaattcccagct
gatgacttggagctgctgctgcagccccgggaatgccggaccacggagcccgggatcccc
aaggatgaaaaactggatgcccaggtgagggccgcggtggagatgtatattgaggactgg
gtcattgtccacagaaggtatcagtacctgagtgcagcatacagccccgtcaccacggag
acacagcgggagcgacagaagggcctcccccaccaggtctttgagcaggacgcttctgga
gacgagaggtccggccctgaggactcggtgaggaagcccctggctggggtcactgaaggg
aatgactcccggcgtggctcgggctccccggaagacacccctcgaagcagtggtgcctct
agcatcttcgacctgaggaacctggcagctgactcattgctgccctctctgctagagcgg
gtggtcccagaagatgtggaccggcgcaatgaaacccttcgacggcagcaccggcccccg
gccctgctcaccctctacccggcgcctgacgaggatgaagccgtggaacgctgtagccgc
ccagagccaccccgcgagcactttgggcagaggatcttggtcaagtgtctgtcgctcaag
ttcgagattgaaattgagcccatctttgggatcttggctctgtatgatgtgcgggagaaa
aagaagatctcggagaacttctacttcgacctgaactcggactccatgaaggggctgctt
cgggctcatggcacccaccctgccatctccaccctggcccgctctgccatcttctctgtg
acctacccctcacctgacatcttcctggtcatcaagttggagaaggtgcttcagcaaggg
gacatcagtgagtgctgtgagccttacatggtattgaaagaagtggacacagccaagaac
aaagagaagctagagaagctgcgcctggcggccgagcagttctgcacccgcctgggccgc
taccgcatgcccttcgcctggacggccgtgcacttggccaacatcgtgagcagcgctggg
cagctggaccgggactctgactcggagggcgagcgccggccagcctggacagaccgccgc
cgtcgggggccccaggaccgggcgagtagtggggacgacgcctgcagcttctctggcttc
cgtccagccacgctaactgtcacaaacttctttaagcaggaggctgagcgactcagtgac
gaggacctcttcaagttcctggctgacatgaggcgcccgtcgtccctgctgcggcgacta
cgtcctgtgactgcccagctcaagatcgacatttctccggctcctgaaaatccccacttc
tgcctctcccctgagctgcttcatatcaagccctacccggaccccaggggccggcccacc
aaggagattctggagttccccgcccgcgaagtctatgccccccataccagctacaggaac
ctgctgtacgtgtacccacacagcctcaactttagcagccgccagggctccgtgcgcaac
cttgctgtgcgagtgcagtacatgacaggcgaggaccccagccaggctctgccggtcatc
tttggcaagtccagctgcagtgaatttacccgcgaggccttcacaccggtggtctaccat
aacaagtcccccgagttctacgaggagttcaagctgcatcttccagcctgcgtgacagag
aaccatcacctgctgttcaccttctaccatgtcagctgccagccccggccgggcactgcc
ctggagacacccgtgggctttacttggatcccactgctgcagcacgggcgcctgaggacc
ggccccttctgtctcccagtgtctgtggaccagccgccgcccagctattccgtgctcaca
cccgacgtggcgcttccgggcatgcgctgggtggacggtcacaagggtgtgttcagtgtg
gagctcacggccgtgtcctctgtgcacccccaggacccctacctggacaagttcttcacc
ctggtgcacgtcctggaggagggagccttcccattccggctcaaggacactgtgctgagc
gagggcaacgtggagcaggagctgcgggccagtcttgcagcactgcgcctggccagcccc
gaacccctcgtggccttctcccaccacgtgctggacaagctcgtgcgtctggtcatcagg
cccccgatcatcagtggccagattgtgaacctgggccgtggagcctttgaagcaatggcc
catgtagtcagccttgttcaccggagcctggaggcagcccaggatgcccgcggtcactgc
ccacagctggctgcctacgtccactatgcctttcgcctgcctggcactgagcccagcctc
ccggatggggcccctccagtgacagtgcaggctgccacactggcccgtggctctggtcgc
cccgcaagcctctacctggcgcgttccaagagcatcagcagcagcaaccctgacctcgcc
gtggcccctggctctgtggatgacgaggtttcccgcatcctggccagcaagggcatcgat
cgctcacactcctgggtgaattccgcttatgctccaggaggcagtaaggctgtgctgcgg
cgggcgcccccttattgtggggccgaccccagacaggccatcgaccgcacctctagccga
gcctcctcctacctcgagggttcctcctcggccccaccagccacccagctgagacccact
gtgcagaagctgcttcacgaggagctggctctgcagtgggtggtcagcagcagtgccgta
cgcgaggccatcctccagcacgcctggttcttcttccagctcatggtgaagagtatggcg
ctgcacctgcttcttggacagcgactagacacaccccgcaagctgcgcttccccggacgc
ttcctggacgacatcactgccttggtgggctctgtgggcctggaggtcatcacccgtgtc
cacaaggatgtggagctggccgagcacctcaacgccagcctggccttcttcctcagtgac
cttctgtccctggtggaccggggctttgtcttcagcctggtccgggcccactacaagcag
gtggccacgcggctccagtcgtcccctaatccagcagccctgctgaccctgcgcatggaa
ttcacccgcatcctgtgcagccacgagcactacgtgaccctcaacctcccctgctgcccc
ctgtcacctccagcctcgccctccccctctgtgtcctccaccacctcccagagctccacc
ttctccagccaagccccagaccccaaggtgaccagcatgttcgaactgagtggaccattc
cggcagcagcacttcctagctgggctcctgctgacggagctggcactggcccttgaacct
gaggctgaaggggcattcctgttgcacaagaaggccatcagtgctgtgcacagcctgcta
tgtggccatgacactgacccccgctacgccgaggccactgtgaaggctcgtgtggccgag
ctgtacctgccactgctttcgattgcacgggataccttgccacggctgcatgactttgct
gagggcccaggtcagcggtcaagactggcctcaatgcttgactcagacacagaaggcgaa
ggggacattgcgggtaccatcaacccctctgtggccatggccattgctggtggcccccta
gcccctggctcccgtgccagcatctcccaggggccaccaacggcttctcgcgcaggctgt
gccctctctgctgagtcaagccggaccttgctggcgtgtgtgctgtgggtgctgaaaaac
gccgagccggcgctcctgcagcgctgggccactgacctgacactcccccagctgggacgt
ctgttggacttgctgtacctttgcctggctgcctttgagtacaaggggaaaaaggccttt
gaacgcatcaacagcctcacattcaaaaaatctctggatatgaaggcacggctggaggaa
gccatcctgggtaccatcggagctcgacaagaaatggttcggcgaagtcgtgagaggagc
ccgtttgggaatccggagaacgtgcgctggcggaagagcgtcacacactggaagcaaacc
tcagaccgcgtggacaagaccaaggatgaaatggaacacgaggccttggtggaagggaac
ctggcaaccgaggcaagcctagtggttctggacacactggagatcatcgtgcagacggtg
atgctttcagaagcccgagagagcgtcttgggggcagtgctgaaggttgtgctgtacagc
ctgggcagtgcccagagtgccctcttcttgcagcatggcctggccacccagagggccctt
gtgtccaagttcccggagctgctgttcgaggaggacacggagctgtgtgccgacctgtgc
ctgaggctcctacgacactgtggcagccgcatcagcaccatccgcacgcacgccagcgcc
tcgctgtacctgctcatgcgacagaacttcgagatcggccacaactttgcccgtgtgaag
atgcaggtcaccatgtctctctcgtccctggtggggacgacgcagaacttcagtgaagag
cacctgcgacgttcactcaaaaccatcctcacctatgctgaggaggacatggggctgcgg
gacagcaccttcgcagagcaggtccaggacctgatgttcaacctgcacatgatcctgacg
gacacagtgaagatgaaggaacaccaggaggaccctgagatgctcatcgacctcatgtac
agaattgcccggggctaccagggctcaccggacctgcggctgacctggttgcagaacatg
gccgggaagcacgcagagctgggcaaccacgccgaggctgcccagtgcatggtgcacgcg
gccgccctcgtggctgagtacctcgccctgctcgaggaccaccgccacctgcccgtgggc
tgcgtttccttccagaacatttcatccaacgtgctagaggagtccgccatctccgacgac
atcctgtcacccgacgaggagggcttctgctccgggaagcacttcactgagctggggctg
gtagggttgctggaacaggcagccggctacttcaccatgggtgggctctacgaggcggtg
aatgaggtctacaagaacctcatccccatcctggaagcccaccgtgactacaagaagctg
gccgcggtgcacggcaaactgcaggaggccttcaccaagatcatgcaccagagttccggc
tgggagccccagcgcgtgttcgggacgtatttccgcgtgggcttctacggcgcccgcttc
ggtgacctggatgagcaggagtttgtgtacaaggagccatcgatcacgaagctggcagag
atctcacaccggctggaggagttctacacggagagatttggcgacgacgtcgttgagatt
atcaaagactctaaccctgtggacaagtccaagcttgactcacaaaaggcctacatccag
atcacgtatgtggaaccgtactttgatacctacgagctcaaggaccgggtgacctacttt
gaccgcaactatgggcttcgcacattcctgttctgcacgccgttcacaccggatgggcgc
gcacacggggagctgcccgagcaacacaagcgtaagacgctgctcagcaccgaccacgcc
ttcccctacatcaagactcgcatccgtgtgtgccaccgggaggagacggtgctgacaccg
gtggaggtggccatcgaggacatgcagaagaagacacgggagctggcctttgccaccgag
caggacccaccagatgctaagatgctacagatggtgcttcagggctctgtagggcccacc
gtgaaccagggtcccctggaggtggcccaggtgtttttagcagagatcccggaagacccc
aagctcttccggcatcacaacaaattgcggctctgcttcaaggacttctgcaagaaatgt
gaggatgcgctgcggaaaaataaggcccttattgggccggaccagaaggagtaccaccgc
gagctggagcgcaactactgccgcctgcgggaggctctgcagcccctgcttacccagcgc
ctgccccagctgatggcacccaccccacccggcctcaggaactccttgaacagagcaagt
ttccgaaaggcagacctctga

DBGET integrated database retrieval system