KEGG   Pan troglodytes (chimpanzee): 456039Help
Entry
456039            CDS       T01005                                 

Gene name
BLVRB
Definition
(RefSeq) flavin reductase (NADPH) isoform X2
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00740  Riboflavin metabolism
ptr00860  Porphyrin and chlorophyll metabolism
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    456039 (BLVRB)
   00860 Porphyrin and chlorophyll metabolism
    456039 (BLVRB)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     456039 (BLVRB)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     456039 (BLVRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD Semialdhyde_dh TrkA_N GDP_Man_Dehyd AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 456039
NCBI-ProteinID: XP_009433877
Ensembl: ENSPTRG00000010999
VGNC: 2095
UniProt: H2QGC7
Position
19
AA seq 206 aa AA seqDB search
MAVKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPQPAHVVVGDVLQAAD
VDKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTK
VPPRLQAVTDDHIRMHKVLQESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHD
LGHFMLRCLTTDEYDGHSTYPSHQYQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaagaagatcgcgatcttcggcgccactggccagaccgggctcaccaccctg
gcgcaggcggtgcaagcaggttacgaagtgacagtgctggtgcgggactcctccaggctg
ccatcagaggggccccagccggcccacgtggtagtgggggatgttctgcaggcagccgat
gtggacaagaccgtggctgggcaggacgctgtcatcgtgctgctgggcacccgcaatgac
ctcagtcccacgacagtgatgtccgagggcgcccggaacattgtggcagccatgaaggct
catggtgtggacaaggtcgtggcctgcacctcggctttcctgctctgggaccctaccaag
gtgcccccacgactgcaggctgtgactgatgaccacatccggatgcacaaggtgctgcag
gaatcaggcctgaagtacgtggctgtgatgccgccacacataggagaccagccgctaact
ggggcgtacacagtgaccctggatggacgagggccctcaagggtcatctccaaacatgac
ctgggccatttcatgctgcgctgcctcaccaccgatgagtacgacggacacagcacctac
ccctcccaccagtaccagtag

DBGET integrated database retrieval system