KEGG   Pan troglodytes (chimpanzee): 456119Help
Entry
456119            CDS       T01005                                 

Gene name
RELB
Definition
(RefSeq) transcription factor RelB isoform X1
  KO
K09253  transcription factor RelB
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04380  Osteoclast differentiation
ptr04625  C-type lectin receptor signaling pathway
ptr05166  Human T-cell leukemia virus 1 infection
ptr05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    456119 (RELB)
   04064 NF-kappa B signaling pathway
    456119 (RELB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    456119 (RELB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    456119 (RELB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    456119 (RELB)
   05169 Epstein-Barr virus infection
    456119 (RELB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    456119 (RELB)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    456119 (RELB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RelB_transactiv RHD_DNA_bind RelB_leu_zip RHD_dimer
Motif
Other DBs
NCBI-GeneID: 456119
NCBI-ProteinID: XP_024207226
Ensembl: ENSPTRG00000011133
VGNC: 10425
Position
19
AA seq 579 aa AA seqDB search
MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEY
IKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVPPAPG
PGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEV
TACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIE
RKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNT
SELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIV
FKTPPYEDLEIVEPVTVNIFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLG
ELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPG
GPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQ
APGPGDGGTASLVGSNMFPNQYREAAFGGGLLSPGPEAT
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggtctgggccagcctctgggccgtccgtccccactggccgggccatgccgagt
cgccgcgtcgccagaccgccggctgcgccggagctgggggccttagggtcccccgacctc
tcctcactctcgctcgccgtttccaggagcacagatgaattggagatcatcgacgagtac
atcaaggagaacggcttcggcctggacgggggacagccgggcccgggcgaggggctgcca
cgcctggtgtctcgcggggcggcgtccctgagcacggtcaccctgggccccgtggcgccc
ccagccacgccgccgccttggggctgccccctgggccgactagtgcccccagcgccgggc
ccgggcccgcagccgcacctggtcatcacggagcagcccaagcagcgcggcatgcgcttc
cgctacgagtgcgagggccgctcggccggcagcatccttggggagagcagcaccgaggcc
agcaagacgctgcccgccatcgagctccgggattgtggagggctgcgggaggtggaggtg
actgcctgcctggtgtggaaggactggcctcaccgagtccacccccacagcctcgtgggg
aaagactgcaccgacggcatctgcagggtgcggctgcggcctcacgtcagcccccggcac
agttttaacaacctgggcatccagtgtgtgaggaagaaggagattgaggctgccattgag
cggaagattcaactgggcattgacccctacaacgctgggtccctgaagaaccatcaggaa
gtagacatgaatgtggtgaggatctgcttccaggcctcatatcgggaccagcagggacag
atgcgccggatggatcccgtgctttccgagcccgtctacgacaagaaatccacaaacacg
tcagagctgcggatttgccgaattaacaaggaaagcgggccgtgcaccggtggcgaggag
ctctacttgctctgcgacaaggtgcagaaagaggacatatcagtggtgttcagcagggcc
tcctgggaaggtcgggctgacttctcccaggccgacgtgcaccgccagattgccattgtg
ttcaagacgccgccctacgaggacctggagattgtcgagcccgtgacagtcaacatcttc
ctgcagcggctcaccgatggggtctgcagcgagccattgcctttcacgtacctgcctcgc
gaccatgacagctacggcgtggacaagaagcggaaacgggggatgcccgacgtccttggg
gagctgaacagctctgacccccatggcatcgagagcaaacggcggaagaaaaagccggcc
atcctggaccacttcctgcccaaccacggctcaggcccgttcctcccgccgtcagccctg
ctgccagaccctgacttcttctctggcaccgtgtccctgcccggcctggagccccctggc
gggcctgacctcctggacgatggctttgcctacgaccctacggcccccacactcttcacc
atgctggacctgctgcccccggcaccgccacacgctagcgctgttgtgtgcagcggaggt
gccggggccgtggttggggagacccccggccctgaaccactgacactggactcgtaccag
gccccgggccccggggatggaggcaccgccagccttgtgggcagcaacatgttccccaat
cagtaccgcgaggcggcctttgggggcggcctcctatccccggggcctgaagccacgtag

DBGET integrated database retrieval system