KEGG   Pan troglodytes (chimpanzee): 456192
Entry
456192            CDS       T01005                                 

Gene name
TULP2
Definition
(RefSeq) tubby-related protein 2 isoform X1
Organism
ptr  Pan troglodytes (chimpanzee)
SSDB
Motif
Pfam: Tub Tub_N DUF3527
Other DBs
NCBI-GeneID: 456192
NCBI-ProteinID: XP_016791961
Ensembl: ENSPTRG00000011262
VGNC: 2211
Position
19
AA seq 531 aa
MSQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANPDASPWLWRSC
LREERLLGDRGLGNPFLRKKVSEAHLPSGIHSALGTVSCGGDGRGERGLPTPRTEAVFRN
LGLQSPFLSWLPDNSDAELEEVSVENGSVSPPPFKQSPRIRRKGWQAHQRPGTRAEGESD
SQDIGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAATNEELSK
ALKGEGGTDSDHMRHEASLAIRSPCPGLEEDMEAYVLRPALPGTMMQCYLTRDKHGVDKA
LFPLYYLYLETSDSLQRFLLAGRKRRRSKTSNYLISLDPTHLSRDGDYFVGKVRSNVFST
KFTIFDNGVNPDREHLIRNTARIRRELGAVCYEPNVLGYLGPRKMTVILPGTNSQNQRIN
VQPLNEQESLLSRYQRGDKQGLLLLHNKTPSWDKENGVYTLNFHGRVTRASVKNFQIVDP
KHRELLETSLAGPEEHLVLQFGRVGPDTFTMDFCFPFSPLQAFSICLSSFN
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtctcaggataatgacacattgatgagagacatcctggggcatgagctcgctgctatg
aggctgcagaagctggaacagcagcggcggctgtttgaaaagaagcagcgacagaagcgc
caggagctcctcatggttcaggccaatcctgacgcttccccgtggctttggcgctcttgt
ctgcgggaggagcgccttttaggtgacagaggccttgggaaccctttcctccggaagaaa
gtgtcagaggcacatctgccctctggcatccacagtgccctgggcaccgtgagctgtggt
ggagacggcaggggcgagcgcggcctcccgacaccgcggacagaagcagtgttcaggaat
ctcggtctccagtcccctttcttatcctggctcccagacaattccgatgcagaattggag
gaagtctccgtggagaatggttccgtctctcccccaccttttaaacagtctccgagaatc
cgacgcaagggttggcaagcccaccaacgacctgggacccgtgcagagggtgagagtgac
tcccaggatatcggagatgcacacaagtcacccaatatgggaccaaaccctggaatggat
ggtgactgtgtatatgaaaacttggccttccaaaaggaagaagacttggaaaagaagaga
gaggcctctgagtctacagggacgaactcctcagcagcaaccaacgaagagttgtccaag
gccctgaaaggcgagggtggcacggacagcgaccatatgaggcacgaagcctccttggca
atccgctccccctgccctgggctggaggaggacatggaagcctacgtgctgcggccagcg
ctcccgggcaccatgatgcagtgctacctcacccgtgacaagcacggcgtggacaaggcc
ttgttccccctctactacctctacctggagacctctgacagcctgcagcgcttcctcctg
gctgggcgaaagagaagaaggagcaaaacttctaattacctcatctctctggatcctaca
cacctatctcgggacggggactatttcgtgggcaaagtcagatccaatgtcttcagcacc
aagttcaccatctttgacaatggggtgaatcctgaccgggagcatttaatcaggaatact
gcccggatcagacgggagctgggggctgtgtgttatgagcccaacgtcttaggatacctg
gggcctcggaaaatgactgtgattctcccaggaaccaacagccagaaccagcgaatcaat
gtccagccactaaatgaacaggagtcgctactgagtcgttaccaacgtggggacaaacaa
gggttgcttttgttgcacaacaaaaccccgtcgtgggacaaggagaacggtgtctacacg
ctcaatttccatggtcgagtcactcgggcttcggtgaagaacttccaaatcgtggatccc
aaacaccgtgagctcctggaaaccagtttagccgggccagaagaacatctggtgctccag
ttcggccgagtgggcccagacacattcaccatggacttctgctttccatttagcccgctc
caggccttcagcatctgcttgtccagtttcaattag

DBGET integrated database retrieval system