KEGG   Pan troglodytes (chimpanzee): 456557Help
Entry
456557            CDS       T01005                                 

Gene name
CYP4B1
Definition
(RefSeq) cytochrome P450 4B1 isoform X1
  KO
K07426  cytochrome P450 family 4 subfamily B polypeptide 1 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     456557 (CYP4B1)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP4 family
   456557 (CYP4B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 456557
NCBI-ProteinID: XP_016818024
Ensembl: ENSPTRG00000000702
VGNC: 6119
UniProt: A0A2I3TMP4
Position
1
AA seq 512 aa AA seqDB search
MVPSFLSLSFSSLGLRASGLILVLGFLKLIRLLLRRQMLAKAMDNFPGPPTHWLFGHALE
IQETGSLDKVVSWAHQFPYAHPLWFGQFIGFLNIYEPDYAQAVYSRGDPKAPDVYDFFLQ
WIGRGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDI
FCDVGHMALNTLMKCTFGRGDTGLGHSRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWL
TPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVQKKIQNRRHLDFLDILLGAWDEDDIK
LSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDSFQWDD
LGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVW
PDPEVFDPLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLD
PSRLPIKMPQLVLRSKNGFHLHLKPLGPGSGK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccagcttcctctccctgagcttctcctccttgggcctgcgggcttctgggctg
atcttggtcttaggctttctcaagctcatccgcctgctgctgcggaggcagatgttggct
aaggctatggacaacttcccagggcctcccacccactggctctttggacatgccctcgag
atccaggagacggggagcctcgacaaagtggtgtcctgggcccaccagttcccatatgcc
cacccactctggttcggacagttcattggcttcctgaacatctatgagcctgactatgcc
caagctgtgtacagccgtggggaccctaaggcccctgatgtgtatgacttcttcctccag
tggattgggagaggcctgctggttcttgaggggcccaagtggttgcagcaccgcaagctg
ctcacacctggctttcattatgatgtgctgaagccctatgtggccgtgttcactgagtct
acacgtatcatgctggacaagtgggaagagaaagctcgggagggtaagtcctttgacatc
ttctgcgatgtgggtcacatggcgctgaacacactcatgaagtgcacctttggaagagga
gacaccggcctgggccacagcagggacagcagctactaccttgcagtcagcgatctcact
ctgttgatgcagcagcgccttgtgtccttccagtaccataatgacttcatctactggctc
accccacatggccgccgcttcctgcgggcctgccaggtggcccatgaccatacagaccag
gtcatcagggagcggaaggcagccctgcaggatgagaaggtgcagaagaagatccagaac
cggaggcacctggacttcctggacattctcctgggtgcctgggatgaagatgacatcaaa
ctgtcagatgcagacctccgggctgaagtggacacattcatgtttgaaggccatgacacc
accaccagtggtatctcctggtttctctactgcatggccctgtaccctgagcaccagcat
cgttgtagagaggaggtccgtgagatcctaggggaccaggactccttccagtgggatgat
ctgggcaagatgacttatctgaccatgtgcatcaaggagagcttccgcctctacccacct
gtgccccaggtgtaccgccagctcagcaagcctgtcacctttgtggatggccggtctcta
cctgcaggaagcctgatctctatgcatatctatgccctccataggaacagtgctgtatgg
cccgaccctgaggtctttgaccctctgcgcttttccactgagaatgcatccaaacgccat
ccctttgcctttatgcccttctctgctgggcccaggaactgcattgggcagcagtttgcc
atgagtgagatgaaggtggtcacagccatgtgcttgctccgctttgagttctctctggac
ccctcacggctgcccatcaagatgccccagcttgtcctgcgctccaagaatggctttcac
ctccacctgaagccactgggccctgggtctgggaagtag

DBGET integrated database retrieval system