KEGG   Pan troglodytes (chimpanzee): 456965Help
Entry
456965            CDS       T01005                                 

Gene name
USP33
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 33 isoform X1
  KO
K11848  ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     456965 (USP33)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   456965 (USP33)
Ubiquitin system [BR:ptr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    456965 (USP33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 DUSP zf-UBP
Motif
Other DBs
NCBI-GeneID: 456965
NCBI-ProteinID: XP_003308213
Ensembl: ENSPTRG00000000882
VGNC: 10902
UniProt: A0A2J8LKJ4
Position
1
AA seq 942 aa AA seqDB search
MTGSNSHITILTLKVLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSHGT
CQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKE
VFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELR
ARGLTGLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAICKSYLKLMTELW
HKSRPGSVVPTTLFQGIKTVNPTFRGYSQQDAQEFLRCLMDLLHEELKEQVMEVEEDPQT
ITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMS
KDWQKEKMCNKINKVNSEGEFDKDRDSISQTVDLNNQETVKVQIHSRASEYITDVHSNDL
STPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYRSVISDIFD
GTIISSVQCLTCDRVSVTLETFQDLSLPIPGKEDLAKLHSSSHPTSIVKAGSCGEAYAPQ
GWIAFFMEYVKRFVVSCVPSWFWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGV
KFCKVQKFPEILCIHLKRFRHELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLL
SVICHHGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSEEAQ
KERRRISNLLNIMEPSLLQFYISRQWLNKFKTFAEPGPISNNDFLCIHGGVPPRKAGYIE
DLVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIEAEKIEKRRKTELEIFIRLNRAFQK
EDSPATFYCISMQWFREWESFVKGKDGDPPGPIDNTKIAVTKCGNVMLRQGADSGQISEE
TWNFLQSIYGGGPEVILRPPVVHVDPDILQAEEKIEVETRSL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgacaggatcaaattcacacataacgatattaaccttaaaggtgttacctcattttgaa
agtcttgggaaacaggaaaaaattcctaacaaaatgtcagcttttcgaaatcattgtcca
catttggattcagttggtgaaataacaaaagaagatttgatacaaaaatcccatggtact
tgtcaggattgtaaagtccaaggaccaaatctttgggcatgtctggagaatagatgttca
tatgttggctgtggtgaatcacaagtagatcacagcaccatacattctcaggagacaaag
cattatctaactgtgaaccttaccactcttcgagtatggtgttatgcttgcagcaaagaa
gtatttttggataggaaattaggaactcagccttcattgcctcatgtaagacaacctcac
caaatacaagaaaacagtgtccaggattttaaaatacccagtaatacaacattaaaaact
cctctggttgccgtatttgatgatctggatatagaagcggatgaagaagatgaacttagg
gcaagaggtcttacaggtttgaaaaatattggaaatacttgttacatgaatgcagctttg
caggctctttctaattgcccacctttgacacagttttttcttgattgtggaggactagct
cgaacagataagaaacctgccatttgtaaaagttatctcaaactaatgacagagctgtgg
cataaaagcaggccaggatctgttgtgcctactactctgtttcaaggaattaaaactgta
aatccaacatttcgggggtattctcagcaggatgctcaagaattccttcgatgtttaatg
gatctgcttcatgaagaattgaaagagcaagtcatggaagtagaagaagatccgcaaacc
ataaccactgaggagacaatggaagaagacaagagccagtcggatgtagattttcagtct
tgtgaatcttgtagcaacagtgatagagcagaaaatgaaaatggctctagatgcttttct
gaagataataatgaaacaacaatgttaattcaggatgatgaaaacaattcagaaatgtca
aaagattggcaaaaagagaagatgtgcaataagattaataaagtaaattctgaaggcgaa
tttgataaagatagagactctatatctcaaacagtcgacttaaacaaccaggaaactgtc
aaagtgcaaatacacagcagagcttcagagtatatcactgatgtccattcgaatgacctg
tctacaccacagatccttccatcaaatgaaggtgttaatccacgtttatcggcaagccct
cctaaatcaggcaatttgtggccaggattggcaccaccacacaaaaaagctcagtctgca
tctccaaagagaaaaaaacagcacaagaaatacagaagtgttatttcagacatatttgat
ggaacaatcattagttcagtgcagtgtctgacttgtgacagggtgtctgtaaccctcgag
acctttcaagatctgtccttgccaattcctggcaaggaagaccttgctaagctgcattca
tcaagtcatccaacttctatagtcaaagcaggatcatgtggcgaagcatatgctccacaa
gggtggatagcttttttcatggaatatgtgaagaggtttgttgtctcatgtgtccctagc
tggttttggggtccagtagtaaccttgcaagattgtcttgctgccttctttgccagagat
gaactaaaaggtgacaatatgtacagttgtgaaaaatgcaaaaagttgagaaatggagtg
aagttttgtaaagtacaaaagtttcctgagattttatgcatccaccttaaaagattcaga
catgaactaatgttttccaccaaaatcagtacccatgtttcatttccgctagaaggcttg
gatcttcagccatttcttgctaaggatagtccagctcaaattgtgacatatgatcttctg
tcagtcatttgccatcatggaactgcaagtagtggacactatatagcctactgccgaaac
aatctaaataatctctggtatgaatttgatgatcagagtgtcactgaagtttcagaatct
actgtacaaaatgcagaagcttacgttcttttctataggaagagcagcgaagaggcacaa
aaagagaggagaaggatatcaaatttattgaacataatggaaccaagcctccttcagttt
tatatttctcgacagtggcttaataaatttaagacctttgccgaacctggccctatttca
aataatgactttctttgtattcatggaggtgttcctccaagaaaagctggttatattgaa
gacctggttttgatgctgcctcagaacatttgggataacctatatagcaggtatggtgga
ggaccagctgtcaaccatctgtacatttgtcatacttgccaaattgaggcggaaaaaatt
gaaaaaagaagaaaaactgaattggaaatttttattcggcttaacagagcgttccaaaaa
gaggactctccagctactttttattgcatcagtatgcagtggtttagagaatgggaaagt
tttgtgaagggtaaagatggagatcctccaggtcctattgacaatactaagattgcagtc
actaaatgtggtaatgtgatgcttaggcaaggagcagattctggccagatttctgaagaa
acatggaattttctgcagtctatttatggtggagggcctgaagttatcctacgacctccg
gttgttcatgttgatccagatatacttcaagcagaagaaaaaattgaagtagaaactcgg
tctttgtaa

DBGET integrated database retrieval system