KEGG   Pan troglodytes (chimpanzee): 457279
Entry
457279            CDS       T01005                                 

Gene name
ARNT
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator isoform X5
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04066  HIF-1 signaling pathway
ptr04934  Cushing syndrome
ptr05200  Pathways in cancer
ptr05204  Chemical carcinogenesis
ptr05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    457279 (ARNT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    457279 (ARNT)
   05204 Chemical carcinogenesis
    457279 (ARNT)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    457279 (ARNT)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    457279 (ARNT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    457279 (ARNT)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    457279 (ARNT)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PRAS
Other DBs
NCBI-GeneID: 457279
NCBI-ProteinID: XP_009429065
Ensembl: ENSPTRG00000001266
VGNC: 444
UniProt: H2R3D7
Position
1
AA seq 789 aa
MAATTANPEMTSDVPSLGPAIASGNPGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQ
RPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSK
PLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGAAPTWTPTTCSGFSAQQVATQATAKT
RTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTA
EGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPD
LTMFPPFSE
NT seq 2370 nt   +upstreamnt  +downstreamnt
atggcggcgactactgccaaccccgaaatgacatcagatgtaccatcactgggtccagcc
attgcctctggaaaccctggacctggaattcaaggtggaggagccattgtccagagggct
attaagcggcgaccagggctggattttgatgatgatggagaagggaacagtaaatttttg
aggtgtgatgatgatcagatgtctaacgataaggagcggtttgccaggtcggatgatgag
cagagctctgcggataaagagagacttgccagggaaaatcacagtgaaattgaacggcgg
cgacggaacaagatgacagcctatatcacagaactgtcagatatggtacccacctgtagt
gccctggctcgaaaaccagacaagctaaccatcttacgcatggcagtttctcacatgaag
tccttgcggggaactggcaacacatccactgatggctcctataagccgtctttcctcact
gatcaggaactaaaacatttgatcttggaggcagcagatggctttctgtttattgtctca
tgtgagacaggcagggtggtgtatgtctctgactccgtgactcctgttttgaaccagcca
cagtctgaatggtttggcagcacactctatgatcaggtgcacccagatgatgtggataaa
cttcgtgagcagctttccacttcagaaaatgccctgacagggcgtatcctggatctaaag
actggaacagtgaaaaaggaaggtcagcagtcttccatgagaatgtgtatgggctcaagg
agatcgtttatttgccgaatgaggtgtggcagtagctctgtggacccagtttctgtgaat
aggctgagctttgtgaggaacagatgcaggaatggacttggctctgtaaaggatggggaa
cctcacttcgtggtggtccactgcacaggctacatcaaggcctggcccccagcaggtgtt
tccctcccagatgatgacccagaggctggccagggaagcaagttttgcctagtggccatt
ggcagattgcaggtaactagttctcccaactgtacagacatgagtaatgtttgtcaacca
acagagttcatctcccgacacaacattgagggtatcttcacttttgtggatcaccgctgt
gtggctactgttggctaccagccacaggaactcttaggaaagaatattgtagaattctgt
catcctgaagaccagcagcttctaagagacagcttccaacaggtagtgaaattaaaaggc
caagtgctgtctgtcatgttccggttccggtctaagaaccaagaatggctctggatgaga
accagctcctttactttccagaacccttactcagatgaaattgagtacatcatctgtacc
aacaccaatgtgaagaactctagccaagaaccacggcctacactctccaacacaatccag
aggccacaactaggtcccacagctaatttacccctggagatgggctcaggacagctggca
cccaggcagcagcaacagcaaacagaattggacatggtaccaggaagagatggactggcc
agctacaatcattcccaggtggttcagcctgtgacaaccacaggaccagaacacagcaag
ccccttgagaagtcagatggtttatttgcccaggatagagatccaagattttcagaaatc
tatcacaacatcaatgcggatcagagtaaaggcatctcctccagcactgtccctgccacc
caacagctattctcccagggcaacacattccctcctaccccccggccggcagagaatttc
aggaatagtggcctagcccctcctgtaaccattgtccagccatcagcttctgcaggacag
atgttggcccagatttcccgccactccaaccccacccaaggagcagccccaacttggacc
cctactacctgctcaggcttttctgcccagcaggtggctacccaggctactgctaagact
cgtacttcccaatttggtgtgggcagctttcagactccatcctccttcagctccatgtcc
ctccctggtgccccaactgcatcgcctggtgctgctgcctaccctagtctcaccaatcgt
ggatctaactttgctcctgagactggacagactgcaggacaattccagacacggacagca
gagggtgtgggtgtctggccacagtggcagggccagcagcctcatcatcgttcaagttct
agtgagcaacatgttcaacaaccgccagcacagcaacctggccagcctgaggtcttccag
gagatgctgtccatgctgggagatcagagcaacagctacaacaatgaagaattccctgat
ctaactatgtttccccccttttcagaatag

DBGET integrated database retrieval system