KEGG   Pan troglodytes (chimpanzee): 457514
Entry
457514            CDS       T01005                                 
Symbol
DNM3
Name
(RefSeq) dynamin-3 isoform X1
  KO
K01528  dynamin 1/3 [EC:3.6.5.5]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04072  Phospholipase D signaling pathway
ptr04144  Endocytosis
ptr04721  Synaptic vesicle cycle
ptr04961  Endocrine and other factor-regulated calcium reabsorption
ptr05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    457514 (DNM3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    457514 (DNM3)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    457514 (DNM3)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    457514 (DNM3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    457514 (DNM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    457514 (DNM3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    457514 (DNM3)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     457514 (DNM3)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    457514 (DNM3)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    457514 (DNM3)
   RhoA-dependent endocytosis
    457514 (DNM3)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   457514 (DNM3)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED PH MMR_HSR1 TetR_C_27
Other DBs
NCBI-GeneID: 457514
NCBI-ProteinID: XP_016788111
Ensembl: ENSPTRG00000001684
VGNC: 10603
Position
1:146892500..147467799
AA seq 873 aa
MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVTSKAEYAEFLHCKGNKFTDFDEVRLEIEAETDRMTGMNKGISSIPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQK
DIDGKKDIKSAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKL
QGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGA
KINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKL
KGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLID
IQVSYINTNHEDFIGFANAQQRSSQVHKKTTIGNQGTNLPPSRQIVIRKGWLTISNIGIM
KGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQR
NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVGNNKAENDENGQAENFSMDPQLE
RQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLME
ESAEQAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTT
QRRPTLSAPLARPTSGRGPAPAIPSPGPHSGAPPVPFRPGPLPPFPSSSDSFGAPPQVPS
RPTRAPPSVPSRRPPPSPTRPTIIRPLESSLLD
NT seq 2622 nt   +upstreamnt  +downstreamnt
atggggaaccgggagatggaggagctgatcccgctggtgaaccgtctgcaggacgcgttt
tcggcgctgggacagagctgcctgctggagctgccgcagatcgccgtggtgggcggccag
agcgccggcaagagctcggtgctcgagaacttcgtgggcagggactttctccctcgaggg
tcgggcattgtaacaagacgacctcttgtgctgcagcttgttacttctaaagcagaatat
gctgagtttctacattgcaaaggaaataaatttacagattttgatgaagttcgccttgag
attgaagcagaaacagaccgcatgactggaatgaataaaggcatttcctccatacccatt
aatttacgagtctattccccacatgtgttaaatctaacccttattgatctacctggaata
actaaagtgcccgtgggagatcagccaccagatatcgagtatcagatcagagaaatgatt
atgcagttcatcacgagggagaactgtctgattttagctgttactccagccaacactgat
cttgcaaactcagatgcgctgaagctagctaaagaagttgatcctcaaggtctgagaacc
attggagttatcaccaaactggaccttatggatgaaggaacggatgccagggatgttcta
gagaacaaactgttgcctcttcgcaggggttacgtgggggtggtaaacagaagccagaag
gacatagatgggaagaaggacataaagtcagccatgctggcagagaggaagtttttcctt
tcccacccggcttacagacatatcgctgaccgaatgggaaccccacacttgcagaaggtc
cttaatcagcaacttaccaaccacattcgggataccctaccaaacttcaggaacaaacta
cagggacagttgctctccatagaacatgaagtagaagcctacaaaaatttcaaaccagaa
gacccaacaaggaagaccaaagcattgctgcagatggttcagcaatttgctgtggacttt
gagaagagaattgaagggtcaggggatcaagtagataccctggaactctcaggtggtgct
aaaatcaatcgtatttttcatgaacgctttccttttgagatagtaaagatggagttcaat
gagaaagaattgcgaagagaaataagctatgcaatcaaaaacatacatggtatcaggaca
gggttgtttactccagacatggcatttgaagcgatagtcaagaaacagattgtaaagttg
aaagggccttccttgaagagtgtggatcttgtaatacaagaattaatcaacactgtgaag
aagtgtaccaaaaaactggcaaacttccccagactctgcgaggaaacggaaaggattgtt
gctaaccacattcgtgagcgagaagggaagacaaaggaccaggtattgctattgattgac
attcaagtctcttacatcaacaccaaccatgaagacttcattggcttcgcaaatgctcag
cagaggagcagtcaggttcacaagaaaaccacaattggaaatcagggaaccaatcttccg
ccttcaaggcaaattgtgattcgcaaggggtggctcaccatcagcaacattggcatcatg
aaaggcggctcgaagggatactggttcgtccttactgcggaaagtttgtcctggtataaa
gatgatgaggaaaaagaaaagaagtacatgcttcccttggacaacctgaaagttcgggat
gtggaaaagagctttatgtctagcaagcacatctttgcactctttaatacagagcaaagg
aatgtatacaaagactatcgcttccttgagctggcatgtgattcccaggaggatgtcgac
agctggaaggcatctctactaagagctggggtctatcctgacaaatctgtagggaacaac
aaagctgaaaatgatgagaatggccaagcagaaaacttttctatggacccacaattggag
aggcaagtggagaccattcgcaacctcgtagactcctacatgtccattatcaacaaatgt
atccgagatctaattccaaaaacaataatgcaccttatgatcaataacgttaaagatttc
ataaattccgagctcctagcacagttgtattcttcagaggaccaaaataccctgatggag
gaatctgctgagcaggctcagcgccgggatgagatgcttcgaatgtaccaagcactgaaa
gaagcccttgggataattggggacatcagcacggccaccgtgtccactccggcaccccct
ccagtggatgactcctggatacagcactctcgcaggtcacctcctccaagccccacaacc
caaaggaggccaacactaagtgctcccctcgcaaggcccacatccggccgaggaccagct
cctgccattccctctcctggcccccactctggggctcctccagtcccattccgtccaggc
ccattacctcctttccccagcagcagtgactccttcggagcccctccacaagttccatct
aggcctacgagggccccgcccagtgtcccaagccggagaccacccccatcaccaactcgt
cccactataatccgcccactagaatcctccctgttagactaa

DBGET integrated database retrieval system