KEGG   Pan troglodytes (chimpanzee): 457747Help
Entry
457747            CDS       T01005                                 

Gene name
BPNT1
Definition
(RefSeq) 3'(2'),5'-bisphosphate nucleotidase 1 isoform X3
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00920  Sulfur metabolism
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    457747 (BPNT1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     457747 (BPNT1)
Transfer RNA biogenesis [BR:ptr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    457747 (BPNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P DUF2788
Motif
Other DBs
NCBI-GeneID: 457747
NCBI-ProteinID: XP_001172472
Ensembl: ENSPTRG00000001996
VGNC: 6730
Position
1
AA seq 366 aa AA seqDB search
MPSFSRLIDSAKARYWTQRGTWVYDNALLLLLKCLWSNVVPGLSPFLSCRSGQEPECTMA
SSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSL
ARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGT
KEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQL
KEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPG
CKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESI
KNALVP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgccatccttctcaagacttattgacagtgccaaagctcggtactggacacagcgaggg
acctgggtctacgataacgcgcttttgctcctcctgaagtgtctttggtccaacgttgtt
ccaggtttgtcaccgtttctctcctgccggtcagggcaagagccagagtgtaccatggct
tccagtaacactgtgttgatgcggttggtagcctctgcatattctattgctcaaaaggca
ggaatgatagtcagacgtgttattgctgaaggagacctgggtattgtggagaagacctgt
gcaacagacctgcagaccaaagctgaccgattggcacagatgagcatatgttcttcattg
gcccggaaattccccaaactcacaattataggggaagaggatctgccttctgaggaagtg
gatcaagagctgattgaagacagtcagtgggaagaaatactgaagcaaccatgcccatcg
cagtacagtgctattaaagaagaagatctcgtggtctgggttgatcctctggatggaacc
aaggaatataccgaaggtcttcttgacaatgtaacagttcttattggaattgcttatgaa
ggaaaagccatagcaggagttattaaccagccatattacaactatgaggcaggaccagat
gctgtgttggggaggacaatctggggagttttaggtttaggcgcctttgggtttcagctg
aaagaagtccctgctgggaaacacattatcacaactactcgatcccatagcaacaagttg
gttactgactgtgttgctgctatgaaccccgatgctgtgctgcgagtaggaggagcagga
aataagattattcagctgattgaaggcaaagcctctgcttatgtatttgcaagtcctggt
tgtaagaagtgggatacttgtgctccagaagttattttacatgctgtgggaggcaagtta
accgatatccatgggaatgttcttcagtaccacaaggatgtgaagcatatgaactctgca
ggagtcctggccacactgaggaattatgactactatgcaagccgagttccagaatctatt
aaaaatgcacttgttccttaa

DBGET integrated database retrieval system