KEGG   Pan troglodytes (chimpanzee): 457922Help
Entry
457922            CDS       T01005                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00562  Inositol phosphate metabolism
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr01522  Endocrine resistance
ptr01524  Platinum drug resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04024  cAMP signaling pathway
ptr04062  Chemokine signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04071  Sphingolipid signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04140  Autophagy - animal
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04210  Apoptosis
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04218  Cellular senescence
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04510  Focal adhesion
ptr04550  Signaling pathways regulating pluripotency of stem cells
ptr04611  Platelet activation
ptr04620  Toll-like receptor signaling pathway
ptr04625  C-type lectin receptor signaling pathway
ptr04630  Jak-STAT signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04660  T cell receptor signaling pathway
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04668  TNF signaling pathway
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04725  Cholinergic synapse
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04810  Regulation of actin cytoskeleton
ptr04910  Insulin signaling pathway
ptr04914  Progesterone-mediated oocyte maturation
ptr04915  Estrogen signaling pathway
ptr04917  Prolactin signaling pathway
ptr04919  Thyroid hormone signaling pathway
ptr04923  Regulation of lipolysis in adipocytes
ptr04926  Relaxin signaling pathway
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease (NAFLD)
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04960  Aldosterone-regulated sodium reabsorption
ptr04973  Carbohydrate digestion and absorption
ptr05100  Bacterial invasion of epithelial cells
ptr05142  Chagas disease (American trypanosomiasis)
ptr05146  Amoebiasis
ptr05160  Hepatitis C
ptr05161  Hepatitis B
ptr05162  Measles
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  HTLV-I infection
ptr05167  Kaposi's sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05205  Proteoglycans in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05213  Endometrial cancer
ptr05214  Glioma
ptr05215  Prostate cancer
ptr05218  Melanoma
ptr05220  Chronic myeloid leukemia
ptr05221  Acute myeloid leukemia
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05224  Breast cancer
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05230  Central carbon metabolism in cancer
ptr05231  Choline metabolism in cancer
ptr05418  Fluid shear stress and atherosclerosis
Module
ptr_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    457922 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    457922 (PIK3CD)
   04015 Rap1 signaling pathway
    457922 (PIK3CD)
   04012 ErbB signaling pathway
    457922 (PIK3CD)
   04370 VEGF signaling pathway
    457922 (PIK3CD)
   04630 Jak-STAT signaling pathway
    457922 (PIK3CD)
   04668 TNF signaling pathway
    457922 (PIK3CD)
   04066 HIF-1 signaling pathway
    457922 (PIK3CD)
   04068 FoxO signaling pathway
    457922 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    457922 (PIK3CD)
   04072 Phospholipase D signaling pathway
    457922 (PIK3CD)
   04071 Sphingolipid signaling pathway
    457922 (PIK3CD)
   04024 cAMP signaling pathway
    457922 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    457922 (PIK3CD)
   04152 AMPK signaling pathway
    457922 (PIK3CD)
   04150 mTOR signaling pathway
    457922 (PIK3CD)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    457922 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    457922 (PIK3CD)
   04218 Cellular senescence
    457922 (PIK3CD)
  Cellular community - eukaryotes
   04510 Focal adhesion
    457922 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    457922 (PIK3CD)
  Cell motility
   04810 Regulation of actin cytoskeleton
    457922 (PIK3CD)
 Organismal Systems
  Immune system
   04611 Platelet activation
    457922 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    457922 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    457922 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    457922 (PIK3CD)
   04660 T cell receptor signaling pathway
    457922 (PIK3CD)
   04662 B cell receptor signaling pathway
    457922 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    457922 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    457922 (PIK3CD)
   04670 Leukocyte transendothelial migration
    457922 (PIK3CD)
   04062 Chemokine signaling pathway
    457922 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    457922 (PIK3CD)
   04923 Regulation of lipolysis in adipocyte
    457922 (PIK3CD)
   04915 Estrogen signaling pathway
    457922 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    457922 (PIK3CD)
   04917 Prolactin signaling pathway
    457922 (PIK3CD)
   04926 Relaxin signaling pathway
    457922 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    457922 (PIK3CD)
  Digestive system
   04973 Carbohydrate digestion and absorption
    457922 (PIK3CD)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    457922 (PIK3CD)
  Nervous system
   04725 Cholinergic synapse
    457922 (PIK3CD)
   04722 Neurotrophin signaling pathway
    457922 (PIK3CD)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    457922 (PIK3CD)
  Development
   04360 Axon guidance
    457922 (PIK3CD)
   04380 Osteoclast differentiation
    457922 (PIK3CD)
  Aging
   04211 Longevity regulating pathway - mammal
    457922 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    457922 (PIK3CD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    457922 (PIK3CD)
   05230 Central carbon metabolism in cancer
    457922 (PIK3CD)
   05231 Choline metabolism in cancer
    457922 (PIK3CD)
   05205 Proteoglycans in cancer
    457922 (PIK3CD)
   05203 Viral carcinogenesis
    457922 (PIK3CD)
   05210 Colorectal cancer
    457922 (PIK3CD)
   05212 Pancreatic cancer
    457922 (PIK3CD)
   05225 Hepatocellular carcinoma
    457922 (PIK3CD)
   05226 Gastric cancer
    457922 (PIK3CD)
   05214 Glioma
    457922 (PIK3CD)
   05221 Acute myeloid leukemia
    457922 (PIK3CD)
   05220 Chronic myeloid leukemia
    457922 (PIK3CD)
   05218 Melanoma
    457922 (PIK3CD)
   05211 Renal cell carcinoma
    457922 (PIK3CD)
   05215 Prostate cancer
    457922 (PIK3CD)
   05213 Endometrial cancer
    457922 (PIK3CD)
   05224 Breast cancer
    457922 (PIK3CD)
   05222 Small cell lung cancer
    457922 (PIK3CD)
   05223 Non-small cell lung cancer
    457922 (PIK3CD)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    457922 (PIK3CD)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    457922 (PIK3CD)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    457922 (PIK3CD)
   04931 Insulin resistance
    457922 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    457922 (PIK3CD)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    457922 (PIK3CD)
   05166 HTLV-I infection
    457922 (PIK3CD)
   05162 Measles
    457922 (PIK3CD)
   05164 Influenza A
    457922 (PIK3CD)
   05161 Hepatitis B
    457922 (PIK3CD)
   05160 Hepatitis C
    457922 (PIK3CD)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    457922 (PIK3CD)
   05169 Epstein-Barr virus infection
    457922 (PIK3CD)
   05165 Human papillomavirus infection
    457922 (PIK3CD)
   05146 Amoebiasis
    457922 (PIK3CD)
   05142 Chagas disease (American trypanosomiasis)
    457922 (PIK3CD)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    457922 (PIK3CD)
   01524 Platinum drug resistance
    457922 (PIK3CD)
   01522 Endocrine resistance
    457922 (PIK3CD)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     457922 (PIK3CD)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    457922 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_p85B PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 457922
NCBI-ProteinID: XP_016809158
Ensembl: ENSPTRG00000000120
VGNC: 8092
UniProt: K7BKN5
Position
1
AA seq 1044 aa AA seqDB search
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFH
MLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARTWGP
GTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAP
HPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMR
QEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggaattctggaccaaggaggagaatcagagcgtc
gtggttgacttcctgctgcccacaggggtctacctgaacttccctgtgtcccgcaatgcc
aacctcagcaccatcaagcagctgctgtggcaccgcgcccagtatgagccgctcttccac
atgctcagtggccccgaggcctatgtgttcacctgcatcaaccagacagcggagcagcaa
gagctggaggacgagcaacggcgtctgtgtgacgtgcagcccttcctgcccgtcctgcgc
ctggtggcccgtgagggcgaccgcgtgaagaagctcatcaactcacagatcagcctcctc
atcggcaaaggcctccacgagtttgactccttgtgcgacccagaagtgaacgactttcgc
gccaagatgtgccaattctgcgaggaggcggccgcccgccggcagcagctgggctgggag
gcctggctgcagtacagtttccccctgcagctggagccctcggctcgaacctgggggcct
ggcaccctgcggctcccgaaccgggcccttctggtcaacgttaagtttgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggacgtgccgctggcgctgatggcctgtgcc
ctgcggaagaaggccacggtgttccggcagccgctggtggagcagccggaagactacacg
ctgcaggtgaacggcaggcatgagtacctgtatggcagctacccgctctgccagttccag
tacatctgcagctgcctgcacagtgggttgacccctcacctgaccatggtccattcctcc
tccatcctcgccatgcgggatgagcagagcaaccctgccccccaggtccagaaaccgcgt
gccaaaccacctcccattcctgcgaagaagccttcctctgtgtccctgtggtccctggag
cagccgttccgcatcgagctcatccagggcagcaaagtgaacgccgacgagcggatgaag
ctggtggtgcaggccgggcttttccacggcaacgagatgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggagcccgtgtggaagcagcggctggagttcgacatcaac
atctgcgacctgccccgcatggcccgtctctgctttgcgctgtacgccgtgatcgagaaa
gccaagaaggctcgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagcttaagaccggggaacgctgcctctat
atgtggccctccgtcccagatgagaagggcgagctgctgaaccccacgggcactgtgcgc
agtaaccccaacacggatagcgccgccgccctgctcatctgcctgcccgaggtggccccg
caccccgtgtactaccctgccctggagaagatcttggagctggggcgacacagcgagtgt
gtgcatgtcactgaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtct
ggggagctgtatgagcacgagaaggacctggtgtggaagctgcggcatgaagtccaggag
cacttcccggaggcgctagcccggctgctgctggtcaccaagtggaacaagcatgaggat
gtggcccagatgctctacctgctgtgctcctggccggagctgcccgtcctgagcgccctg
gagctgctagacttcagcttccccgattgccacgtaggctccttcgccatcaagtcgctg
aggaaactgacggacgatgagctgttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctggactgcgagctgaccaaattcctgctggaccgggccctggccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccgtcggtg
gccctgcgcttcggcctcatcctggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaaactgaaggccctgaatgacttcgtcaag
ctgagctctcagaagacccccaagccccagaccaaggagctgatgcacttgtgcatgcgg
caggaggcctacctagaggccctctcccacctgcagtccccactcgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaagcccctgtgg
atcatgtacagcaacgaggaggcaggcagtggcggcagcgtgggcatcatctttaagaac
ggggatgacctccggcaggacatgctgaccctgcagatgatccagctcatggacgtcctg
tggaagcaggaggggctggacctgaggatgaccccctacggctgcctccccaccggggac
cgcacaggcctcattgaggtggtactccgttcagacaccatcgccaacatccaactcaac
aagagcaacatggcagccacagccgccttcaacaaggacgccctgctcaactggctgaag
tccaagaacccgggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctattgtgtggccacatatgtgctgggcatcggcgatcggcacagcgacaacatcatg
atccgagagagtgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgcgagcgtgtcccattcatcctcacctatgactttgtccat
gtgattcagcaggggaagactaataatagtgagaaatttgaacggttccggggctactgt
gaaagggcctacaccatcctgcggcgccacgggcttctcttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtatctcaaggac
tccctggcactggggaaaacagaggaggaggcactgaagcacttccgagtgaagtttaac
gaagccctccgtgagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gacaacaggcagtag

DBGET integrated database retrieval system