KEGG   Pan troglodytes (chimpanzee): 458655Help
Entry
458655            CDS       T01005                                 

Gene name
COMT
Definition
(RefSeq) catechol O-methyltransferase isoform X2
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00140  Steroid hormone biosynthesis
ptr00350  Tyrosine metabolism
ptr01100  Metabolic pathways
ptr04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    458655 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    458655 (COMT)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    458655 (COMT)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     458655 (COMT)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   458655 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_15 CmcI PCMT Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 458655
NCBI-ProteinID: XP_003317142
Ensembl: ENSPTRG00000014070
VGNC: 12831
UniProt: H2QL91
Position
22
AA seq 271 aa AA seqDB search
MLEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFVLQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY
DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFE
CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggccccgcctctgctgttggcagctgtgttgctgggcctggtgctgctggtg
gtgctgctgctgcttctgaggcactggggctggggcctgtgccttatcggctggaacgag
ttcgtcctgcagcccatccacaacctgctcatgggtgacaccaaggagcagcgcatcctg
aaccacgtgctgcagcatgcggagcccgggaacgcacagagcgtgctggaggccatcgac
acctactgcgagcagaaggagtgggccatgaacgtgggcgacaagaaaggcaagatcgtg
gacgccgtgattcaggagcaccagccctccgtgctgctggagctgggggcctactgtggc
tactcagctgtgcgcatggcccgcctgctgtcaccaggggcgaggctgatcaccatcgag
atcaaccccgactgtgccgccatcacccagcggatggtggatttcgctggcgtgaaggac
aaggtcacccttgtggttggagcgtcccaggacatcatcccccagctgaagaagaagtat
gatgtggacaccctggacatggtcttcctcgaccactggaaggaccggtacctgccagac
acgcttctcttggaggaatgtggcctgctgcggaaggggacagtgctactggctgacaac
gtgatctgcccaggtgcgccagacttcctagcacacgtgcgtgggagcagctgctttgag
tgcacacactaccaatcgttcctggaatacagggaggtggtggacggcctggagaaggcc
atctacaagggcccaggcagcgaagcagggccctga

DBGET integrated database retrieval system