KEGG   Pan troglodytes (chimpanzee): 458862Help
Entry
458862            CDS       T01005                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04024  cAMP signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04310  Wnt signaling pathway
ptr04330  Notch signaling pathway
ptr04350  TGF-beta signaling pathway
ptr04520  Adherens junction
ptr04630  Jak-STAT signaling pathway
ptr04720  Long-term potentiation
ptr04916  Melanogenesis
ptr04919  Thyroid hormone signaling pathway
ptr04922  Glucagon signaling pathway
ptr05016  Huntington's disease
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05164  Influenza A
ptr05165  Human papillomavirus infection
ptr05166  HTLV-I infection
ptr05167  Kaposi's sarcoma-associated herpesvirus infection
ptr05168  Herpes simplex infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05203  Viral carcinogenesis
ptr05206  MicroRNAs in cancer
ptr05211  Renal cell carcinoma
ptr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    458862 (EP300)
   04330 Notch signaling pathway
    458862 (EP300)
   04350 TGF-beta signaling pathway
    458862 (EP300)
   04630 Jak-STAT signaling pathway
    458862 (EP300)
   04066 HIF-1 signaling pathway
    458862 (EP300)
   04068 FoxO signaling pathway
    458862 (EP300)
   04024 cAMP signaling pathway
    458862 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    458862 (EP300)
  Cellular community - eukaryotes
   04520 Adherens junction
    458862 (EP300)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    458862 (EP300)
   04919 Thyroid hormone signaling pathway
    458862 (EP300)
   04916 Melanogenesis
    458862 (EP300)
  Nervous system
   04720 Long-term potentiation
    458862 (EP300)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    458862 (EP300)
   05206 MicroRNAs in cancer
    458862 (EP300)
   05203 Viral carcinogenesis
    458862 (EP300)
   05211 Renal cell carcinoma
    458862 (EP300)
   05215 Prostate cancer
    458862 (EP300)
  Neurodegenerative diseases
   05016 Huntington's disease
    458862 (EP300)
  Infectious diseases
   05152 Tuberculosis
    458862 (EP300)
   05166 HTLV-I infection
    458862 (EP300)
   05164 Influenza A
    458862 (EP300)
   05161 Hepatitis B
    458862 (EP300)
   05168 Herpes simplex infection
    458862 (EP300)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    458862 (EP300)
   05169 Epstein-Barr virus infection
    458862 (EP300)
   05165 Human papillomavirus infection
    458862 (EP300)
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     458862 (EP300)
Transcription factors [BR:ptr03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    458862 (EP300)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    458862 (EP300)
Mitochondrial biogenesis [BR:ptr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    458862 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Motif
Other DBs
NCBI-GeneID: 458862
NCBI-ProteinID: NP_001231599
Ensembl: ENSPTRG00000014418
VGNC: 5978
Position
22
AA seq 2411 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINS
MVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
GNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQ
PLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMP
NMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
GDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQM
PTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
NPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPN
AAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSM
AQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNI
PLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPS
LPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSST
EVNSQAIPEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELK
TEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVD
PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGE
VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIGLCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTG
QQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPG
PPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHL
EPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSP
LKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPI
PGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGG
MSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYP
PQQQQRMQHHMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQH
MLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQ
TSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLN
SNLSQSTLDIH
NT seq 7236 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctatttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attaatcagcttcagacaagtcttggcatggtacaagatgcagcttctaaacataaacag
ctgtcagaattgctgcgatctggtagttcccctaacctcaatatgggagttggtggccca
ggtcaagtcatggccagccaggcccaacagagcagtcctggattaggtttgataaatagc
atggtcaaaagcccaatgacacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcctacgcagtcaacaggtatgatgaacagtccagtaaatcag
cctgccatgggaatgaacacagggatgaatgcgggcatgaatcctggaatgttggctgca
ggcaatggacaagggataatgcctaatcaagtcatgaacggttcaattggagcaggccga
gggcgacagaatatgcagtacccaaacccaggcatgggaagtgctggcaacttactgact
gagcctcttcagcagggctctccccagatgggaggacaaacaggattgagaggcccccag
cctcttaagatgggaatgatgaacaaccccaatccttatggttcaccatatactcagaat
cctggacagcagattggagccagtggccttggtctccagattcagacaaaaactgtacta
tcaaataacttatctccatttgctatggacaaaaaggcagttcctggtggaggaatgccc
aacatgggtcaacagccagccccgcaggtccagcagccaggcctggtgactccagttgcc
caagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatccagcag
caacttgttctccttttgcatgctcacaagtgccagcgccgggaacaggccaatggggaa
gtgaggcagtgcaaccttccccactgtcgcacaatgaagaatgtcctaaaccacatgaca
cactgccagtcaggcaagtcttgccaagtggcacactgtgcatcttctcgacaaatcatt
tcacactggaagaattgtacaagacatgattgtcctgtgtgtctccccctcaaaaatgct
ggtgataagagaaatcaacagccaattttgactggagcacccgttggacttggaaatcct
agctctctaggggtgggtcaacagtctgcccccaacctaagcactgttagtcagattgat
cccagctctatagaaagagcctatgcagctcttggactaccctatcaagtaaatcagatg
ccgacacaaccccaggtgcaagcaaagaaccagcagaatcagcagcctgggcagtctccc
caaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggtgta
ggagttcaaacgccgagtcttctttctgactcaatgttgcattcagccataaattctcaa
aacccaatgatgagtgaaaatgccagtgtgccctccctgggtcctatgccaacagcagct
caaccatccactactggaattcggaaacagtggcacgaagatattactcaggatcttcga
aatcatcttgttcacaaactcgtccaagccatatttcctacgccggatcctgctgcttta
aaagacagacggatggaaaacctagttgcatatgctcggaaagttgaaggggacatgtat
gaatctgcaaacaatcgagcggaatactaccaccttctagctgagaaaatctataagatc
cagaaagaactagaagaaaaacgaaggaccagactacagaagcagaacatgctaccaaat
gctgcaggcatggttccagtttccatgaatccagggcctaacatgggacagccgcaacca
ggaatgacttctaatggccctctacctgacccaagtatgatccgtggcagtgtgccaaac
cagatgatgcctcggataactccacaatctggtttgaatcaatttggccagatgagcatg
gcccagccccctattgtaccccggcaaacccctcctctgcagcaccatggacagttggct
caacctggagctctcaacccgcctatgggctatgggcctcgtatgcaacagccttccaac
cagggccagttccttcctcagactcagttcccatcacagggaatgaatgtaacaaatatc
cctttggctccgtccagcggtcaagctccagtgtctcaagcacaaatgtctagttcttcc
tgcccggtgaactctcctataatgcctccagggtctcaggggagccacattcactgtccc
cagcttcctcaaccagctctgcatcagaattcaccctcacctgtacctagtcgtaccccc
acccctcaccatactcccccaagcataggggctcagcagccaccagcaacaacaattcca
gcccctgttcctacaccacctgccatgccacctgggccacagtcccaggctctacatccc
cctccaaggcagacacctacaccaccaacaacacaacttccccaacaagtgcagccttca
cttcctgctgcaccttctgctgaccagccccagcagcagcctcgctcacagcagagcaca
gcagcgtctgttcctaccccaacagcaccgctgcttcctccgcagcctgcaactccactt
tcccagccagctgtaagcattgaaggacaggtatcaaaccctccatctactagtagcaca
gaagtgaattctcaggccattcctgagaagcagccttcccaggaagtgaagatggaggcc
aaaatggaagtggatcaaccagaaccagcagatactcagccggaggatatttcagagtct
aaagtggaagactgtaaaatggaatctaccgaaacagaagagagaagcactgagttaaaa
actgaaataaaagaggaggaagaccagccaagtacttcagctacccagtcatctccggct
ccaggacagtcaaagaaaaagattttcaaaccagaagaactacgacaggcactgatgcca
acattggaggcactttaccgtcaggatccagaatcccttccctttcgtcaacctgtggac
cctcagcttttaggaatccctgattactttgatattgtgaagagccccatggatctttct
accattaagaggaagttagacactggacagtatcaggagccctggcaatatgtcgatgat
atttggcttatgttcaataatgcctggttatataaccggaaaacatcacgggtatacaaa
tactgctccaagctctctgaggtctttgaacaagaaattgacccagtgatgcaaagcctt
ggatactgttgtggcagaaagttggagttctctccacagacactgtgttgctacggcaaa
cagttgtgcacaatacctcgtgatgccacttattacagttaccagaacaggtatcatttc
tgtgagaagtgtttcaatgagatccaaggggagagcgtttctttgggggatgacccttcc
cagcctcaaactacaataaataaagaacaattttccaagagaaaaaatgacacactggat
cctgaactgtttgttgaatgtacagagtgcggaagaaagatgcatcagatctgtgtcctt
caccatgagatcatctggcctgctggattcgtctgtgacggctgtttaaagaaaagtgca
cgaactaggaaagaaaataagttttctgctaaaaggttgccatctaccagacttggcacc
tttctagagaatcgtgtgaatgactttctgaggcgacagaatcaccctgagtcaggagag
gtcactgttagagtagttcatgcttctgacaaaaccgtggaagtaaaaccaggcatgaaa
gcaaggtttgtggacagtggagagatggcagaatcctttccataccgaaccaaagccctc
tttgcctttgaagaaattgatggtgttgacctgtgcttctttggcatgcatgttcaagag
tatggctctgactgccctccacccaaccagaggagagtatacatatcttacctcgatagt
gttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaatcctaattgga
tatttagaatatgtcaagaaattaggttacacaacagggcatatttgggcatgtccacca
agtgagggagatgattatatcttccactgccatcctcctgaccagaagatacctaagccc
aagcgactgcaggaatggtacaaaaaaatgcttgacaaggctgtatcagagcgtattgtc
catgactacaaggatatttttaaacaagctactgaagatagattaacaagtgcaaaggaa
ttgccttacttcgagggtgatttctggcccaatgttctggaagaaagcattaaggaactg
gaacaggaggaagaagagagaaaacgagaggaaaacaccagcaatgaaagcacagatgtg
accaagggagacagcaaaaatgctaaaaagaagaataataagaaaaccagcaaaaataag
agcagcctgagtaggggcaacaagaagaaacccgggatgcccaatgtatctaacgacctc
tcacagaaactatatgccaccatggagaagcataaagaggtcttctttgtgatccgcctc
attgctggccctgctgccaactccctgcctcccattgttgatcctgaccctctcatcccc
tgcgatctgatggatggtcgggatgcatttctcacgctggcaagggacaagcacctggag
ttctcttcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcacacg
cagagccaggaccgctttgtctacacctgcaatgaatgcaagcaccatgtggagacacgc
tggcactgtactgtctgtgaggattatgacttgtgtatcacctgctataacactaaaaac
catgaccacaaaatggagaaactaggccttggcttagatgatgagagcaacaaccagcag
gctgcagccacccagagcccaggcgattctcgccgcctgagtatccagcgctgcatccag
tctctggtccatgcttgccagtgtcggaatgccaattgctcactgccatcctgccagaag
atgaagagggttgtgcagcataccaagggttgcaaacggaaaaccaatggcgggtgcccc
atctgcaagcagctcattgggctctgctgctaccatgccaagcactgccaggagaacaaa
tgcccggtgccgttctgcctaaacatcaagcagaagctccggcagcaacagctgcagcac
cgactacagcaggcccaaatgcttcgcaggaggatggccagcatgcagcggactggtgtg
gttgggcagcaacagggcctcccttcgcccactcctgccactccaacaacaccaactggc
caacagccaaccaccccgcagacgccccagcccacttctcagcctcagcctacccctccc
aatagcatgccaccctacttgcccaggactcaagctgctggccctgtgtcccagggtaag
gcagcaggccaggtgactcctccaacccctcctcagactgctcagccaccccttccaggg
cccccacctgcagcagtggaaatggcaatgcagattcagagagcagcggagacgcagcgc
cagatggcccacgtgcaaatttttcaaaggccaatccaacaccagatgcccccgatgact
cccatggcccccatgggtatgaacccacctcccatgaccagaggtcccagtgggcatttg
gagccagggatgggaccgacagggatgcagcagcagccaccctggagccaaggaggattg
cctcagccccagcaactacagtctgggatgccaaggccagccatgatgtcagtggcccag
catggtcaacctttgaacatggctccacaaccaggattgggccaggtaggtgtcagccca
ctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctcaggtct
cccagctctcccctgcagcagcaacaggtgcttagtatccttcacgccaacccccagctg
ttggctgcattcatcaagcagcgggctgccaagtatgccaactctaatccacaacccatc
cctgggcagcctggcatgccccaggggcagccagggctgcagccacctaccatgccaggt
cagcagggggtccactccaatccagccatgcagaacatgaatccaatgcaggcgggtgtt
cagagggctggcctgccccagcagcaaccacagcagcaacttcagccacccatgggaggg
atgagcccccaggctcagcagatgaacatgaaccacaacaccatgccttcacaattccga
gacatcttgagacgacagcaaatgatgcaacagcagcagcaacagggagcagggccagga
ataggccctggaatggccaaccataaccagttccagcaaccccaaggagttggctaccca
ccacagcagcagcagcggatgcagcatcacatgcaacaaggaaatatgggacagataggc
cagcttccccaggccttgggagcagaggcaggtgccagtctacaggcctatcagcagcga
ctccttcagcaacagatggggtcccctgttcagcccaaccccatgagcccccagcagcat
atgctcccaaatcaggcccagtccccacacctacaaggccagcagatccctaattctctc
tccaatcaagtgcgctctccccagcctgtcccttctccacggccacagtcccagcccccg
cactccagcccttccccaaggatgcagcctcagccttctccacaccacgtttccccacag
acaagttccccacatcctggactggtagctgcccaggccaaccccatggaacaagggcat
tttgctagcccggaccagaattcaatgctttctcagcttgctagcaatccaggcatggca
aacctccatggtgcaagcgccacggacctgggactcagcaccgataactcagacttgaat
tcaaacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system