KEGG   Pan troglodytes (chimpanzee): 458883Help
Entry
458883            CDS       T01005                                 

Gene name
CYB5R3
Definition
(RefSeq) cytochrome b5 reductase 3
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    458883 (CYB5R3)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     458883 (CYB5R3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 458883
NCBI-ProteinID: NP_001289347
Ensembl: ENSPTRG00000014461
VGNC: 6693
UniProt: G2HEQ1
Position
22
AA seq 278 aa AA seqDB search
MKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSA
RIDGNLVVRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFR
GPNGLLVYQGKGKFAIRPDKKSNPVIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTV
CHLLFANQTEKDILLRPELEELRNEHSARFKLWYTLDRAPEAWDYSQGFVNEEMIRDHLP
PPEEEPLVLMCGPPPMIQYACLPNLDRVGHPKERCFAF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttccagcgctccacgccagccatcaccctcgagagcccggacatcaagtac
ccgctgcggctcatcgaccgggagatcatcagccatgacacccggcgcttccgctttgcc
ctgccgtcaccccagcacatcctgggcctccctgtcggccagcacatctacctctcggct
cgaattgatggaaacctggtcgtccggccctatacacccgtctccagtgatgatgacaag
ggcttcgtggacctggtcatcaaggtttacttcaaggacacccatcccaagtttcccgcc
ggagggaagatgtctcagtacctggagagcatgcagattggagacaccattgagttccgg
ggccccaacgggctgctggtctaccagggcaaagggaagttcgccatccgacctgacaaa
aagtccaaccctgtcatcaggacagtgaagtctgtgggcatgatcgcgggagggacaggc
atcaccccgatgctgcaggtgatccgtgccatcatgaaggaccctgatgaccacactgtg
tgccacctgctctttgccaaccagaccgagaaggacatcctgctgcgacctgagctggag
gaactcaggaacgaacattctgcacgcttcaagctctggtacacgctggacagagcccct
gaagcctgggactacagccagggcttcgtgaatgaggagatgatccgggaccaccttcca
cccccagaggaggagccgctagtgctgatgtgtggccccccacccatgatccagtacgcc
tgccttcccaacctggaccgcgtgggccaccccaaggagcgctgcttcgccttctga

DBGET integrated database retrieval system