KEGG   Pan troglodytes (chimpanzee): 459220
Entry
459220            CDS       T01005                                 

Gene name
FOXN2
Definition
(RefSeq) forkhead box protein N2
  KO
K09407  forkhead box protein N
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    459220 (FOXN2)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix developmental regulators
    459220 (FOXN2)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 459220
NCBI-ProteinID: XP_001150448
Ensembl: ENSPTRG00000011908
VGNC: 256
UniProt: H2QHW2 A0A6D2WLH9
Position
2A
AA seq 431 aa
MGPVIGMTPDKRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLN
WLHESTNLLTNFSLGSEGLPIVSPLYDIEGDDVPSFGPACYQNPEKKSATSKPPYSFSLL
IYMAIEHSPNKCLPVKEIYSWILDHFPYFATAPTGWKNSVRHNLSLNKCFQKVERSHGKV
NGKGSLWCVDPEYKPNLIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDA
AAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKE
DHNYSASSMAAQRCASRSSVSSLSSVDEVYEFIPKNSHVGSDGSEGFHSEEDTDVDYEDD
PLGDSGYASQPCAKISEKGQSGKKMRKQTCQEIDEELKEAAGSLLHLAGIRTCLGSLIST
AKTQNQKQRKK
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgggtccagtaattggaatgactccagataagagagctgaaaccccaggagctgaaaag
attgcaggattaagccagatttacaaaatgggaagcttgcctgaagctgttgatgctgcc
aggccgaaggccactctagtggacagtgagtcagcagatgatgaactcacaaacttgaac
tggcttcatgaaagcactaatcttctaacaaacttcagcctcggaagtgagggtcttcca
attgttagtccattgtatgacatagagggagatgatgtgccatcctttggaccagcttgc
taccagaacccagaaaaaaaatcagcaacttcaaagcccccatactcctttagtcttctc
atttatatggccattgagcactctccaaataaatgtttgcctgtcaaagaaatttatagc
tggattctggaccattttccgtattttgctactgcaccaacaggctggaagaattctgtt
cgacataatctgtccctgaataaatgttttcagaaagtggaaagaagccatggcaaggtt
aatggaaaaggttccttatggtgtgttgatccggaatataaacccaatcttatccaggca
ctgaagaagcaacctttttcttcagcatcttcacaaaatggttctttatcacctcactat
ttaagctctgtaatcaagcagaaccaggtgcgaaacctcaaagaatctgatattgatgct
gctgctgcaatgatgcttttaaatacttctatagaacaaggaattttagaatgtgagaag
cctcttcctcttaaaacagcattgcaaaaaaagaggagttacggcaatgcatttcatcat
cccagtgctgtacgattacaagagagtgattctttagccaccagcattgatccaaaagaa
gatcacaattacagtgcaagtagcatggcagcacagcgttgtgcatccaggtctagcgtg
tcttccctgtcttctgtggatgaggtatatgaatttatcccaaagaatagtcacgtggga
agtgatggcagtgaaggatttcacagtgaagaagatacagacgttgactatgaagatgat
cctcttggagacagtggctatgcatcacagccttgtgcaaaaatctctgaaaaagggcag
tcaggcaaaaagatgcgaaaacagacatgtcaagaaattgatgaggagctcaaagaggca
gctggatctctgctccaccttgctggaattcgtacatgtttaggttccctaataagtact
gcaaagacacaaaatcaaaagcaacggaaaaaatag

DBGET integrated database retrieval system