KEGG   Pan troglodytes (chimpanzee): 459306
Entry
459306            CDS       T01005                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53 isoform X4
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptr03036]
    459306 (ANKRD53)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    459306 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 459306
NCBI-ProteinID: XP_001145845
Ensembl: ENSPTRG00000012039
VGNC: 15
UniProt: A0A2I3SEH1 A0A6D2WQ81
Position
2A
AA seq 343 aa
MASAGSTARRAGSGSWHSERGEGRGARPQPTPSGSMQQANKVSLKATWTDAESKQPSQPL
PDLADHLSAQATALATPRRPASFTPPRAEPSPSEESDQTAIDQTAIGSYYQLFAAAVGNV
EWLRFCLNQSLREIPTDDKGFTAIHFAAQWGKLACLQVLVEEYKFPVDLLTNNSQTPLHL
VIHRDNTTVALPCIYYLLEKGADLNAQTCNGSTPLHLAARDGLLDCMKVLVQSGANVHAQ
DAMGYKPIDFCKIWNHRACARFLKDAMWKKDKKDFAREMTKMKMFKSQLTLMEHNYLIEY
QGQGCSVHFPFAFSPITPETLLWQDMSLLSDCGFLWRRRELCF
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggcctccgcgggcagcaccgctcggcgggcgggctcgggaagctggcactcagaaagg
ggagaagggagaggtgctcggccgcagccaactccaagtggctccatgcagcaggcgaac
aaagtctccttgaaggccacctggactgacgcggagtccaagcagcccagccagcccctg
cccgacctcgcagaccacctcagtgcgcaggcgactgccctcgccacgccgcgccgccct
gcctcgttcaccccgccccgcgctgaacccagccccagcgaggagtccgaccagacggca
atcgaccagacggcgatcgggagctactaccagctgttcgcagcggctgtgggcaacgtg
gaatggctgcgattctgtctgaaccagagcctcagggaaatccccaccgacgacaagggc
ttcactgccatccacttcgccgcccaatggggcaagcttgcatgcctgcaggtcctggta
gaggagtacaagtttcccgtggacctgctgaccaacaatagccagacacccctgcacctc
gtcatccacagggacaacaccaccgtggccctcccctgcatctactacctgctggagaaa
ggcgcagacctcaatgctcagacatgcaacggctccacgcccctgcacctggcagcccgt
gacggcttgctggactgtatgaaggtcctggtgcagagtggcgccaacgtccatgcccaa
gatgccatgggctacaaacccattgacttctgcaaaatatggaaccaccgtgcctgtgcc
cggttcttgaaggatgccatgtggaaaaaggacaagaaggactttgcccgtgagatgacg
aaaatgaagatgttcaagagccagctgaccctcatggagcacaactacctgattgagtat
caaggtcaaggatgcagtgtgcacttcccatttgccttttcccccatcacaccagagact
ctcctatggcaggacatgtctctactatcagactgtggattcctttggagaagaagggaa
ttgtgtttctaa

DBGET integrated database retrieval system