KEGG   Pan troglodytes (chimpanzee): 459449
Entry
459449            CDS       T01005                                 

Gene name
NPAS2
Definition
(RefSeq) neuronal PAS domain-containing protein 2 isoform X4
  KO
K09026  neuronal PAS domain-containing protein 2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    459449 (NPAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    459449 (NPAS2)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    459449 (NPAS2)
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS HLH PAS_9
Other DBs
NCBI-GeneID: 459449
NCBI-ProteinID: XP_003309213
Ensembl: ENSPTRG00000012287
VGNC: 313
UniProt: H2QIF6 A0A6D2XM62
Position
2A
AA seq 824 aa
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKE
MCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLARCH
QHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
RQELALEDPPSEALHSSALKDKGSSLEPRQHFNALDVGASGLNTSHSPSASSRSSHKSSH
TAMSEPTSTPTKLMAEASTPALPRSATLPQELPVPGLSQAATMPAPLPSPSSCDLTQQLL
PQTVLQSTPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDS
NVQMFLQQPAVSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTSQHLL
RESSVISTQGPKPMRSSQLMQSSGRSGSSLVSPFSSATAVLPPSLNLTTPASTSQDASQC
QPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDAHPA
NSSSAPMPVLLMGQAVLHPSFPASQPSPLQPAQARQQPPQHYLQVQAPTSLHSEQQDSLL
LSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR
NT seq 2475 nt   +upstreamnt  +downstreamnt
atggatgaagatgagaaagacagagccaagagagcttctcgaaacaagtctgagaagaag
cgtcgggaccagttcaatgttctcatcaaagagctcagttccatgctccctggcaacacg
cggaaaatggacaaaaccaccgtgttggaaaaggtcatcggatttttgcagaaacacaat
gaagtctcagcgcaaacggaaatctgtgacattcagcaagactggaagccttcattcctc
agtaatgaagaattcacccagctgatgttggaggcattagatggcttcattatcgcagtg
acaacagacggcagcatcatctatgtctctgacagtatcacgcctctccttgggcattta
ccgtcggatgtcatggatcagaatttgttaaatttcctcccagaacaagaacattcagaa
gtttataaaatcctttcttcccatatgcttgtgacggattccccctccccagaatactta
aaatctgacagcgatttagagttttattgccatcttctcagaggcagcttgaacccaaag
gaatttccaacttatgaatacataaaatttgtaggaaattttcgctcttacaacaatgtg
cctagcccctcctgtaatggttttgacaacaccctttcaagaccttgccgggtgccacta
ggaaaggaggtttgcttcattgccaccgttcgtctggcaacaccacaattcttaaaggaa
atgtgcatagttgacgaacctttagaggaattcacttcaaggcatagcttggaatggaaa
tttttatttctggatcacagagcacctccaatcataggatacctgccttttgaagtgctg
ggaacctcaggctatgactactaccacattgatgacctggagctcctggccaggtgtcac
cagcacctgatgcagtttggcaaagggaagtcgtgttgctaccggtttctgaccaaaggt
cagcagtggatctggctgcagactcactactacatcacctaccatcagtggaactccaag
cccgagttcatcgtgtgcacacactcggtggtcagttacgcagatgtccgggtggaaagg
aggcaggagctggctctggaagacccgccatccgaggccctccactcctcagcactaaag
gacaagggctcaagcctggaacctcggcagcactttaatgcactcgacgtgggtgcctcg
ggccttaataccagtcattcgccatcggcgtcctcaagaagttcccacaaatcctcgcac
acagccatgtcagaacccacctccactcccaccaagctgatggcagaggccagcaccccg
gctttgccaagatcagccaccctgccccaagagttacctgtccccgggctcagccaggca
gccaccatgccggcccctctgccttccccatcgtcctgcgacctcacacagcagctcctg
cctcagaccgttctgcagagcacacccgctcccatggcacagttttcggcacagttcagc
atgttccagaccatcaaagaccagctagagcagcggacgcggatcctgcaggccaatatc
cggtggcaacaggaagagctccacaagatccaggagcagctctgcctggtccaggactcc
aatgtccagatgttcctgcagcagccagctgtatccctgagcttcagcagcacccagcga
cctgaggctcagcagcagctacagcaaaggtcagctgcagtgactcagccccagctcggg
gcgggcccccaacttccagggcagatctcctctgcccaggtcacaagccagcacctgctc
agagaatcaagtgtgatatcaacccagggtccaaagccaatgagaagctcacagctaatg
cagagcagcggccgctctggaagcagcctagtgtccccgttcagcagcgccacagctgtg
ctcccgccaagtctgaatctgaccacacctgcttccacctcccaggatgccagccagtgc
cagcccagcccagacttcagccatgatcggcagctcaggctgttgctgagccagcccatc
cagcccatgatgcccgggtcctgtgacgcaaggcagccctcggaagtcagcaggacggga
cggcaagtcaagtacgcacagagccagaccgtgtttcaaaatccagacgcacaccccgcc
aacagcagcagcgccccgatgcccgtcctgctgatggggcaggcggtgctccaccccagc
ttccccgcctcccaaccatcgcccctgcagcctgcacaggcccggcagcagccaccgcag
cactacctgcaggtacaggcaccaacctctttgcacagtgagcagcaggactcgctactt
ctctccacctactcacaacagccagggaccctgggctacccccaaccacccccagcacag
ccccagcccctacgtcctccccgaagggtcagcagtctgtctgagtcgtcaggcctccag
cagccgccccgataa

DBGET integrated database retrieval system