KEGG   Pan troglodytes (chimpanzee): 459459Help
Entry
459459            CDS       T01005                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    459459 (MAP4K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    459459 (MAP4K4)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     459459 (MAP4K4)
Protein kinases [BR:ptr01001]
 Serine/threonine kinases: STE group
  STE20 family
   459459 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 459459
NCBI-ProteinID: XP_016804619
Ensembl: ENSPTRG00000012294
VGNC: 299
Position
2A
AA seq 1393 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQEYIRRQLEEEQRHLE
VLQQQLLQEQAMLLECRWREMEEHRQAERLQRQLQQEQAYLLSLQHDHRRPHPQHSQQPP
PPQQERSKPSFHAPEPKAHYEPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRS
ESFSNGNSESVHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPPKFAHHHLRSQ
DPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQ
GSGQQNSQAGQRNSTSSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSG
ERFRVRSSSKSEGSPSQRLENAVKKPEDKKEVFRPLKPAGEVDLTALAKELRAVEDVRPP
HKVTDYSSSSEESGTTDEEDDDVEQEGADESTSGPEDTRAASSLNLSNGETESVKTMIVH
DDVESEPAMTPSKEGTLIVRQSTVDQKRASHHESNGFAGRIHLLPDLLQQSHSSSTSSTS
SSPSSSQPTPTMSPQTPQDKLTANETQSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTT
VTSVVGFSCDGMRPEAIRQDPTRKGSVVNVNPTNTRPQSDTPEIRKYKKRFNSEILCAAL
WGVNLLVGTESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYL
SWLRNKILHNDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKP
YHKFMAFKSFGELVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHVR
KNPHSMIQCSIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVA
YIRSNQTMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQV
YFMTLGRTSLLSW
NT seq 4182 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactcccctgcaaaaagtctggtggacatcgacctctcctccctgcgggat
cctgctgggatttttgagctggtggaagtggttggaaatggcacctatggacaagtctat
aagggtcgacatgttaaaacgggtcagttggcagccatcaaagttatggatgtcactgag
gatgaagaggaagaaatcaaactggagataaatatgctaaagaaatactctcatcacaga
aacattgcaacatattatggtgctttcatcaaaaagagccctccaggacatgatgaccaa
ctctggcttgttatggagttctgtggggctgggtccattacagaccttgtgaagaacacc
aaagggaacacactcaaagaagactggatcgcttacatctccagagaaatcctgagggga
ctggcacatcttcacattcatcatgtgattcaccgggatatcaagggccagaatgtgttg
ctgactgagaatgcagaggtgaaacttgttgactttggtgtgagtgctcagctggacagg
actgtggggcggagaaatacgttcataggcactccctactggatggctcctgaggtcatc
gcctgtgatgagaacccagatgccacctatgattacagaagtgatctttggtcttgtggc
attacagccattgagatggcagaaggtgctccccctctctgtgacatgcatccaatgaga
gcactgtttctcattcccagaaaccctcctccccggctgaagtcaaaaaaatggtcgaag
aaattttttagttttatagaagggtgcctggtgaagaattacatgcagcggccctctaca
gagcagcttttgaaacatccttttataagggatcagccaaatgaaaggcaagttagaatc
cagcttaaggatcatatagatcgcaccaggaagaagagaggcgagaaagatgaaactgag
tatgagtacagtgggagtgaggaagaagaggaggaagtgcctgaacaggaaggagagcca
agttccattgtgaacgtgcctggtgagtctactcttcgtcgagatttcctgagactgcag
caggagaacaaggaacgttccgaggctcttcggagacaacagttactacaggagcaacag
ctccgggagcaggaagaatataaaaggcaactgctggcagagagacagaagcggattgag
cagcagaaagaacagaggcgacggctagaagagcaacaaaggagagagcgtgaagctaga
aggcagcaggaacgtgaacagcgaaggagagaacaagaagaaaagaggcgtctagaggag
ttggagagaaggcgcaaagaagaagaggagaggagacgggcagaagaagaaaagaggaga
gttgaaagagaacaggagtatatcaggcgacagctagaagaggagcagcggcacttggaa
gtccttcagcagcagctgctccaggagcaggccatgttactggagtgccgatggcgggag
atggaggagcaccggcaggcagagaggctccagaggcagttgcaacaagaacaagcatat
ctcctgtctctacagcatgaccataggaggccgcacccgcagcactcgcagcagccgcca
ccaccgcagcaggaaaggagcaagccaagcttccatgctcccgagcccaaagcccactac
gagcctgctgaccgagcgcgagaggtggaagatagatttaggaaaactaaccacagctcc
cctgaagcccagtctaagcagacaggcagagtattggagccaccagtgccttcccgatca
gagtctttttccaatggcaactccgagtctgtgcatcccgccctgcagagaccagcggag
ccacaggtacagtggtcccacctggcatctctcaagaacaatgtttcccctgtctcgcga
tcccattccttcagtgacccttctcctcccaaatttgcacaccaccatcttcgttctcag
gacccatgtccaccttcccgcagtgaggtgctcagtcaaagctctgactctaagtcagag
gcgcctgaccctacccaaaaggcttggtctagatcagacagtgacgaggtgcctccaagg
gttcctgtgagaacaacatctcgctcccctgttctgtcccgtcgagattccccactgcag
ggcagtgggcagcagaatagccaggcaggacagagaaactccaccagcagtattgagccc
aggcttctgtgggagagagtggagaagctggtgcccagacctggcagtggcagctcctca
gggtccagcaactcaggatcccagcccgggtctcaccctgggtctcagagtggctccggg
gaacgcttcagagtgagatcatcatccaagtctgaaggctctccatctcagcgcctggaa
aatgcagtgaaaaaacctgaagataaaaaggaagttttcagacccctcaagcctgctggc
gaagtggatctgaccgcactggccaaagagcttcgagcagtggaagatgtacggccacct
cacaaagtaacggactactcctcatccagtgaggagtcggggacgacggatgaggaggac
gacgatgtggagcaggaaggggctgacgagtccacctcaggaccagaggacaccagagca
gcgtcatctctgaatttgagcaatggtgaaacggaatctgtgaaaaccatgattgtccat
gatgatgtagaaagtgagccggccatgaccccatccaaggagggcactctaatcgtccgc
cagagtacagttgaccaaaagcgtgccagccatcatgagagcaatggctttgccggtcgc
attcacctcttgccagatctcttacagcaaagccattcctcctccacttcctccacctcc
tcctccccatcctccagccagccgacacccaccatgtccccacagacaccccaggacaag
ctcactgctaatgagactcagtccgctagtagcacactccagaaacacaaatcttcctcc
tcctttacaccttttatagaccccagattactacagatttctccatctagcggaacaaca
gtgacttctgtggtgggattttcctgtgatgggatgagaccagaagccataaggcaagat
cctacccggaaaggctcagtggtcaatgtgaatcctaccaacactaggccacagagtgac
accccggagattcgtaaatacaagaagaggtttaactctgagattctgtgtgctgcctta
tggggagtgaatttgctagtgggtacagagagtggcctgatgctgctggacagaagtggc
caagggaaggtctatcctctgatcaaccgaagacgatttcaacaaatggacgtacttgag
ggcttgaatgtcttggtgacaatatctggcaaaaaggataagttacgtgtctactatttg
tcctggttaagaaataaaatacttcacaatgatccagaagttgagaagaagcagggatgg
acaaccgtaggggatttggaaggatgtgtacattataaagttgtaaaatatgaaagaatc
aaatttctggtgattgctttgaagagttctgtggaagtctatgcatgggcaccaaagcca
tatcacaaatttatggcctttaagtcatttggagaattggtacataagccattactggtg
gatctcactgttgaggaaggccagaggttgaaagtgatctatggatcctgtgctggattc
catgctgttgatgtggattcaggatcagtctatgacatttatctaccaacacatgtaaga
aagaacccacactctatgatccagtgtagcatcaaaccccatgcaatcatcatcctcccc
aatacagatggaatggagcttctggtgtgctatgaagatgagggggtttatgtaaacaca
tatggaaggatcaccaaggatgtagttctacagtggggagagatgcctacgtcagtagca
tatattcgatccaatcagacaatgggctggggagagaaggccatagagatccgatctgtg
gaaactggtcacttggatggtgtgttcatgcacaaaagggctcaaagactaaaattcttg
tgtgaacgcaatgacaaggtgttctttgcctctgttcggtctggtggcagcagtcaggtt
tatttcatgaccttaggcaggacttctcttctgagctggtag

DBGET integrated database retrieval system