KEGG   Pan troglodytes (chimpanzee): 460267Help
Entry
460267            CDS       T01005                                 

Gene name
PLCD1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 isoform X1
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00562  Inositol phosphate metabolism
ptr01100  Metabolic pathways
ptr04020  Calcium signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04919  Thyroid hormone signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
Module
ptr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    460267 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    460267 (PLCD1)
   04070 Phosphatidylinositol signaling system
    460267 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    460267 (PLCD1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    460267 (PLCD1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     460267 (PLCD1)
Membrane trafficking [BR:ptr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    460267 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    460267 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 PH EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 TEP1_N
Motif
Other DBs
NCBI-GeneID: 460267
NCBI-ProteinID: XP_016796186
Ensembl: ENSPTRG00000014751
VGNC: 2508
UniProt: K7C8Z4
Position
3
AA seq 779 aa AA seqDB search
MQCLGIRSRSRSRSRELYLQEQSLKVAALNGRRLGLQDDEDLQALLKGSQLLKVKSSSWR
RERFYKLQEDCKTIWQESRKVMRTPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCF
SIVFKDQRNTLDLIAPSPADAQHWVLGLHKIIHHSGSMDQRQKLQHWIHSCLRKADKNKD
NKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQTDSLEDEEIEAFYKMLTQRVEIDRT
FAEAVGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLM
YLLSADGSAFSLAHRRVYQDMGQPLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGC
RCLELDCWDGPNQEPIIYHGYTFTSKILFCDVLRAIRDYAFKASPYPVILSLENHCTLEQ
QRVMARHLHAILGPMLLNRPLDGITNSLPSPEQLKGKILLKGKKLGGLLPPAGEGGPEAT
VVSDEDEAAEMEDEAVRSRVQHKPKEDKLRLAQELSDMVIYCKSVHFGGFSSPGTPGQAF
YEMASFSENRALRLLQESGNGFVRHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVAL
NFQTPGPEMDVYQGRFQDNGACGYVLKPAFLRDPNGTFNPRALAQGPWWARKRLNIRVIS
GQQLPKVNKNKNSIVDPKVTVEIHGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDL
ALVRFLVEDYDASSKNDFIGQSTIPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcctggggatccggagccggagccggagccgctccagggagctctacctgcag
gagcagagccttaaggtggcggcactcaatggacggaggctgggcctacaggatgatgag
gatctacaggcgctgctgaagggcagccagctcctgaaggtgaaatccagctcatggagg
agagagcgcttctacaagttgcaggaggactgcaagaccatctggcaggagtcccgcaag
gtcatgcggaccccggagtcccagctgttctccatcgaggacattcaggaggtgcgaatg
gggcaccgcacggagggtctggagaagttcgcccgtgatgtgcccgaggaccgctgcttc
tccattgtcttcaaggaccagcgcaatacactagacctcatcgccccatcgccagctgat
gcccagcactgggtgctggggctgcacaagatcatccaccactcaggctccatggaccag
cgtcagaagctacagcactggattcactcctgcttgcgaaaagctgacaaaaacaaggac
aacaagatgagcttcaaggagctgcagaacttcctgaaggagctcaacatccaggtggac
gacagctatgcccggaagatcttcagggagtgtgaccactcccagacagactccctggag
gatgaggagattgaggccttctacaagatgctgacccagcgggtggagatcgaccgcacc
ttcgccgaggccgtgggctcaggggagactctgtcggtggatcagttagtgacgttcctg
cagcaccagcagcgggaggaggcggcagggcctgcgctggccctctccctcattgagcgc
tatgagcccagcgagactgccaaggcgcagcggcagatgaccaaggacggcttcctcatg
tacttactgtcggctgacggcagcgccttcagcctggcacaccgccgtgtctaccaggac
atgggccagccgcttagccactacctggtgtcctcttcacacaacacctacctgctggag
gaccagctagccgggcccagcagcactgaagcctacatccgggcactgtgcaaaggctgc
cgatgcctggagcttgactgctgggacgggcccaaccaggaaccaatcatctaccacggc
tatactttcacttccaagatcctcttctgcgatgtgctcagggccatccgggactatgcc
ttcaaggcgtccccctaccctgtcatcctatccctggagaaccactgcacactggagcag
cagcgcgtgatggcgcggcacctgcacgccatcctgggccccatgctgttgaaccgacca
ctggatgggatcaccaacagcctgccctcccctgagcaactgaaggggaagatcctgctg
aaggggaagaagctcggggggctcctgccccctgcaggggagggtggccctgaggccact
gtggtgtcagacgaagacgaggctgctgagatggaggatgaggcagtgaggagccgtgtg
cagcacaagcccaaggaggacaagctcaggctagcacaggagctctctgacatggtcatt
tactgcaagagtgtccactttgggggcttctccagtcctggcacccctgggcaggccttc
tacgagatggcgtccttctctgagaaccgtgcccttcgactgctccaagaatcaggaaac
ggctttgtccgccacaacgtggggcacctgagcagaatctacccggctggatggagaaca
gactcctccaactacagccccgtggagatgtggaatgggggctgccagatcgtggccctg
aatttccagacacctgggccagagatggacgtgtaccagggccgcttccaggacaacggg
gcctgtgggtacgtgctgaagcccgccttcctgcgagaccccaacggcacctttaacccc
cgcgccctggctcaggggccctggtgggcacggaagcggctcaacatcagggtcatttcg
gggcagcagctgccaaaagtcaacaagaataagaattcaattgtggaccccaaagtgaca
gtggagatccatggcgtgagccgggacgtggccagccgccagactgctgtcatcaccaac
aatggtttcaacccatggtgggacacggagtttgcgtttgaggtagttgtgcctgacctt
gccctcgtccgcttcttggtggaagattatgatgcctcctccaagaatgacttcattggc
cagagtaccatccccttgaacagcctcaagcaaggataccgccatgtccacctcatgtct
aagaacggggaccagcatccatcagccaccctctttgtgaagatctccctccaggactag

DBGET integrated database retrieval system