KEGG   Pan troglodytes (chimpanzee): 460457Help
Entry
460457            CDS       T01005                                 

Gene name
CACNA2D3
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-3 isoform X1
  KO
K04860  voltage-dependent calcium channel alpha-2/delta-3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04260  Cardiac muscle contraction
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04921  Oxytocin signaling pathway
ptr05410  Hypertrophic cardiomyopathy (HCM)
ptr05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
ptr05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    460457 (CACNA2D3)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    460457 (CACNA2D3)
  Circulatory system
   04260 Cardiac muscle contraction
    460457 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    460457 (CACNA2D3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    460457 (CACNA2D3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    460457 (CACNA2D3)
   05414 Dilated cardiomyopathy (DCM)
    460457 (CACNA2D3)
Ion channels [BR:ptr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated
   460457 (CACNA2D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGCC_alpha2 VWA_N dCache_1 VWA_3 VWA VWA_2 dCache_2 Cache_3-Cache_2 VWA_CoxE Phage_holin_6_1
Motif
Other DBs
NCBI-GeneID: 460457
NCBI-ProteinID: XP_016796808
Ensembl: ENSPTRG00000015031
VGNC: 7961
UniProt: H2R883
Position
3
AA seq 1091 aa AA seqDB search
MAGPGSPRRASRGASALLAAALLYAALGDVVRSEQQIPLSVVKLWASAFGGEIKSIAAKY
SGSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKH
EFDADLQYEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYN
KDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFD
CRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEE
LHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSI
CSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQ
ISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVA
MPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELR
LLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVM
TNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDL
HPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSD
KGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGS
FVYSIPFSTGPVNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCAS
LDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEIEGAVMNKLLTMGSFKRITL
YDYQAMCRANKESSDGAHGLLDPYNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQ
KLKQTLEPCDTEYPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCE
SVAPITMAPIEIRYNESLKCERLKAQKIRRRPESCHGFHPEENARECGGAPSLEAQTVLL
LLPLLLMLFSR
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggccgggccgggctcgccgcgccgcgcgtcccggggggcctcggcgcttctcgccgcc
gcgcttctctacgccgcgctgggggacgtggtgcgctcggagcagcagataccgctctcc
gtggtgaagctctgggcctcggcttttggtggggagataaaatccattgctgctaagtac
tccggttcccagcttctgcaaaagaaatacaaagagtatgagaaagacgttgccatagaa
gaaatcgatggcctccaactggtaaagaagctggcaaagaacatggaagagatgtttcac
aagaagtctgaggccgtcaggcgtctggtggaggctgcagaagaagcacacctgaaacat
gaatttgatgcagacttacagtatgaatacttcaatgctgtgctgataaatgaaagggac
aaagacgggaattttttggagctggggaaggaattcatcttagccccaaatgaccatttt
aataatttgcctgtgaacatcagtctaagtgacgtccaagtaccaacgaacatgtacaac
aaagaccctgcaattgtcaatggggtttattggtctgaatctctaaacaaagtttttgta
gataactttgaccgtgacccatctctcatatggcagtactttggaagtgcaaagggcttt
tttaggcagtatccggggattaaatgggaaccagatgagaatggagtcattgccttcgac
tgcaggaaccgaaaatggtacatccaggcagcaacttctccgaaagacgtggtcatttta
gttgacgtcagtggcagcatgaaaggactccgtctgactatcgcgaagcaaacagtctca
tccattttggatacacttggggatgatgacttcttcaacataattgcttataatgaggag
cttcactatgtggaaccttgcctgaatggaactttggtgcaagccgacaggacaaacaaa
gagcacttcagggagcatctggacaaacttttcgccaaaggaattggaatgttggatata
gctctgaatgaggccttcaacattctgagtgatttcaaccacacgggacaaggaagtatc
tgcagtcaggccatcatgctcataactgatggggcggtggacacctatgatacaatcttt
gcgaaatacaattggccagatcgaaaggttcgcatcttcacatacctcattggacgagag
gctgcgtttgcagacaatctaaagtggatggcctgtgccaacaaaggattttttacccag
atctccaccttggctgatgtgcaggagaatgtcatggaataccttcacgtgcttagccgg
cccaaagtcatcgaccaggagcatgatgtggtgtggaccgaagcttacattgacagcact
ctccctcaggcacaaaagctgactgatgatcagggccccgtcctgatgaccactgtagcc
atgcctgtgtttagtaagcagaacgaaaccagatcgaagggcattcttctgggagtggtt
ggcacagatgtcccagtcaaagaacttctgaagaccatccccaaatacaagttagggatt
cacggttatgcctttgcaatcacaaataatggatatatcctgacgcatccggaactcagg
ctgctgtacgaagaaggaaaaaagcgaaggaaacctaactatagtagcgttgacctctct
gaggtggaatgggaagaccgagatgacgtgttgagaaatgctatggtgaatcgaaagacg
gggaagttttccatggaggtgaagaagacagtggacaaagggaaacgggttttggtgatg
acaaatgactactattatacagacatcaagggtactcctttcagtttaggtgtggcgctt
tccagaggtcatgggaaatatttcttccgagggaatgtaaccatcgaagaaggcctgcat
gacttagaacatcccgatgtgtccttggcagatgaatggtcctactgcaacactgaccta
caccctgagcaccgccatctgtctcagttagaagcgattaagctctacctaaaaggcaaa
gaacctctgctccagtgtgataaagaattgatccaagaagtcctttttgacgcggtggtg
agtgcccccattgaagcgtattggaccagcctggccctcaacaaatctgaaaattctgac
aagggcgtggaggttgccttcctcggcactcgcacgggcctctccagaatcaacctgttt
gtcggggctgagcagctcaccaatcaggacttcctgaaagctggcgacaaggagaacatt
tttaacgcagaccatttccctctctggtaccgaagagccgctgagcagattccagggagc
ttcgtctactcgatcccgttcagcactggaccagtcaataaaagcaatgtggtgacagcg
agtacatccatccagctcctggatgaacggaaatctcctgtggtggcagctgtaggcatt
cagatgaaacttgaatttttccaaaggaagttctggactgccagcagacagtgtgcttcc
ctggatggcaaatgctccatcagctgtgatgatgagactgtgaattgttacctcatagac
aataatggatttattttggtgtctgaagactacacacagactggagacttttttggtgag
atcgagggagctgtgatgaacaaattgctaacaatgggctcctttaaaagaattaccctt
tatgactaccaagccatgtgtagagccaacaaggaaagcagcgatggcgcccatggcctc
ctggatccttataatgccttcctctctgcagtaaaatggatcatgacagaacttgtcttg
ttcctggtggaatttaacctctgcagttggtggcactccgatatgacagctaaagcccag
aaattgaaacagaccctggagccttgtgatactgaatatccagcattcgtctctgagcgc
accatcaaggagactacagggaatattgcttgtgaagactgctccaagtcctttgtcatc
cagcaaatcccaagcagcaacctgttcatggtggtggtggacagcagctgcctctgtgaa
tctgtggcccccatcaccatggcacccattgaaatcaggtataatgaatcccttaagtgt
gaacgtctaaaggcccagaagatcagaaggcgcccagaatcttgtcatggcttccatcct
gaggagaatgcaagggagtgtgggggtgcaccgagtctcgaagcccagacagtcctcctt
ctgctccctctgcttttgatgctcttctcaaggtga

DBGET integrated database retrieval system