KEGG   Pan troglodytes (chimpanzee): 460970Help
Entry
460970            CDS       T01005                                 

Gene name
BDH1
Definition
(RefSeq) D-beta-hydroxybutyrate dehydrogenase, mitochondrial isoform X2
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00072  Synthesis and degradation of ketone bodies
ptr00650  Butanoate metabolism
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    460970 (BDH1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    460970 (BDH1)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     460970 (BDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Motif
Other DBs
NCBI-GeneID: 460970
NCBI-ProteinID: XP_009445404
Ensembl: ENSPTRG00000015794
VGNC: 53359
Position
3
AA seq 330 aa AA seqDB search
MVIQFCKILPLGEMRRPLLLGSTSFIPIGRRTYASAAEPVGSKAVLVTGCDSGFGFSLAK
HLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKAVEIVRSSLKD
PEKGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMTKSFLPLIRRAKGRVVNI
SSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSPESI
QAIAKKMWDELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYT
RYHPMDYYWWLRMQIMTHLPGAISDMIYIR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggtaatacagttttgcaagatactacccttaggggaaatgagacgcccactattgctt
ggttctacttcctttatcccgattggccgtcggacttatgccagtgcggcggagccggtt
ggcagcaaagctgtcctggtcacaggctgtgactctggatttgggttctcattggccaag
catctgcattcaaaaggcttccttgtgtttgctggctgcttgatgaaggacaaaggccat
gatggggtcaaggagctggacagcctaaacagtgaccgattgagaaccgtccagctcaat
gtctgcagcagcgaagaggtggagaaagcggtggagattgtccgctcgagcctgaaggac
cctgagaaagggatgtggggcctcgttaacaatgccggcatctcaacgttcggggaggtg
gagttcaccagcctggagacctacaagcaggtggcagaagtgaacctttggggcacagtg
cggatgacgaaatcctttctccccctcatccgaagggccaaaggccgcgtcgtcaatatc
agcagcatgctgggccgcatggccaacccggcccgctccccgtactgcatcaccaagttc
ggggtagaggctttctcggactgcctgcgctatgagatgtaccccctgggcgtgaaggtc
agcgtggtggagcccggcaacttcatcgctgccaccagcctttacagccctgagagcatt
caggccatcgccaagaagatgtgggacgagctgcctgaggtcgtgcgcaaggactacggc
aagaagtactttgatgaaaagatcgccaagatggagacctactgcagcagtggctccaca
gacacgtcccctgtcatcgatgctgtcacacacgccctgaccgccaccaccccctacacc
cgctaccaccccatggactactactggtggctgcgaatgcagatcatgacccacttgcct
ggagccatctccgacatgatctacatccgctga

DBGET integrated database retrieval system