KEGG   Pan troglodytes (chimpanzee): 461126Help
Entry
461126            CDS       T01005                                 

Gene name
BST1
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 isoform X1
  KO
K18152  ADP-ribosyl cyclase 2 [EC:3.2.2.6 2.4.99.20]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00760  Nicotinate and nicotinamide metabolism
ptr01100  Metabolic pathways
ptr04970  Salivary secretion
ptr04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    461126 (BST1)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    461126 (BST1)
   04972 Pancreatic secretion
    461126 (BST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptr04090]
    461126 (BST1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ptr00537]
    461126 (BST1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     461126 (BST1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     461126 (BST1)
CD molecules [BR:ptr04090]
 Proteins
  461126 (BST1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ptr00537]
 Enzymes
  461126 (BST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 461126
NCBI-ProteinID: XP_001160329
Ensembl: ENSPTRG00000015929
VGNC: 572
UniProt: H2RAA9
Position
4
AA seq 318 aa AA seqDB search
MAAQGCAASRLLQLLLQLLLPLLLLAAGGARARWRGEGTSAQLRDIFLGRCAEYRALLSP
EQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFA
ENTRRFMPLSDALYGRVADFLSWCRQENDSGLDYQSCPTSEDCENNPVDSFWKRASIQYS
KDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITQIEIWVMHEIGGPNVESCRE
GSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCVLKSAAAATQRKAPSLYTEQ
SAGLIIPLLLVLASGTQL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccaggggtgcgcggcatcgcggctgctccagctgctgctgcagcttctgctt
ccactgctgctgctggcggcgggcggggcgcgcgcgcggtggcgcggggagggcaccagc
gcacagttgcgggacatcttcctgggccgctgcgccgagtaccgcgcactgctgagtccc
gagcagcggaacaagaactgcacagccatctgggaagcctttaaagtggcgctggacaag
gatccctgctctgtgctgccctcagactatgacctttttattaacttgtccaggcactct
attcccagagataagtccctgttctgggaaaatagccacctccttgttaacagctttgca
gaaaacacccgtcgttttatgcccctgagcgatgctctgtatggcagggttgcagatttc
ttgagctggtgtcgacaggaaaatgactctggactcgattaccaatcctgccctacatca
gaagactgtgaaaataatcctgtggattccttttggaaaagggcatccatccagtattcc
aaggatagttctggggtgatccacgtcatgctgaatggttcagagccaacaggagcctat
cccatcaaaggtttttttgcagattatgaaattccaaacctccagaaggaaaaaattaca
caaattgagatctgggttatgcatgaaattgggggacccaatgtggaatcctgcagggaa
ggcagcatgaaagtcctggaaaagaggctgaaggacatggggttccagtacagctgtatt
aatgattatcgaccagtgaagctcttacagtgcgtggaccacagcacccatcctgactgt
gtcttaaagtcggcagcagccgctactcaaagaaaagccccaagtctttatacagaacaa
agtgcgggtcttatcattcccctccttctggtcctggcttccgggactcaactgtaa

DBGET integrated database retrieval system