KEGG   Pan troglodytes (chimpanzee): 461273
Entry
461273            CDS       T01005                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00230  Purine metabolism
ptr00240  Pyrimidine metabolism
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    461273 (DCK)
   00240 Pyrimidine metabolism
    461273 (DCK)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     461273 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_33 AAA_28 CoaE
Other DBs
NCBI-GeneID: 461273
NCBI-ProteinID: XP_517245
Ensembl: ENSPTRG00000016139
VGNC: 587
UniProt: K7DFS5 A0A6D2XLH0
Position
4
AA seq 260 aa
MATPPKRSCPSLSASSEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCN
VQSTQDEFEELTMSQKNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESECMNEIEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPETCLHRMYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKYESLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagagaagctgcccgtctctctcagccagctctgaggggacccgc
atcaagaaaatctccatcgaagggaacatcgctgccgggaagtcaacatttgtgaatatc
cttaaacaattgtgtgaagattgggaagtggttcctgaacctgttgccagatggtgcaat
gttcaaagtactcaagatgaatttgaggaacttacaatgtctcagaaaaatggtgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccaaacatatgcc
tgtctcagtcgaataagagctcagcttgcctctctgaatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgaatgcatgaatgagatagagtggacaatttatcaagactggcatgac
tggatgaataaccaatttggccaaagccttgaattggatggaatcatttatcttcgagcc
actccagagacatgcttacatagaatgtatttacggggaagaaatgaagagcaaggcatt
cctcttgaatatttagagaagcttcattataaacatgaaagctggctcctgcataggaca
ctgaaaaccaacttcgattatcttcaagaggtgcctatcttaacactggatgttaatgaa
gactttaaagacaaatatgaaagtctggttgaaaaggtcaaagagtttttgagtactttg
tga

DBGET integrated database retrieval system