KEGG   Pan troglodytes (chimpanzee): 461312
Entry
461312            CDS       T01005                                 

Gene name
CLOCK
Definition
(RefSeq) circadian locomoter output cycles protein kaput isoform X1
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04710  Circadian rhythm
ptr04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    461312 (CLOCK)
  09159 Environmental adaptation
   04710 Circadian rhythm
    461312 (CLOCK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    461312 (CLOCK)
   03036 Chromosome and associated proteins [BR:ptr03036]
    461312 (CLOCK)
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     461312 (CLOCK)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    461312 (CLOCK)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    461312 (CLOCK)
SSDB
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9
Other DBs
NCBI-GeneID: 461312
NCBI-ProteinID: XP_001144028
Ensembl: ENSPTRG00000016072
VGNC: 2027
UniProt: A0A6D2XC51 H2QPH9
Position
4
AA seq 847 aa
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSF
SSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQ
VVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAP
LYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVAC
GAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQQSSQEQQLTSVQQPSQAQLT
QPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPD
PSKVQPQ
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcgattgttgacagagatgacagtagt
atttttgatgggttggtggaagaagatgacaaggacaaagcgaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctagaaagatggacaaatctactgttctgcagaaaagcattgatttt
ttacgaaaacataaagaaatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgacagatggaagcataatatatgtgtctgagagtgtaacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagaa
ggggaacattcagaggtttataaaatactctctactcatctgctggaaagtgattcatta
accccagaatatttaaaatcaaaaaatcagttagaattctgttgtcatatgctgcgagga
acaatagacccaaaggagccatctacctatgaatatgtaaaatttataggaaatttcaaa
tctttaaacagtgtatcctcttcagcacacaatggttttgaaggaactatacaacgcaca
cataggccatcttatgaagatagagtttgttttgtagctactgtcaggttagctacacct
cagttcatcaaggaaatgtgcactgttgaagaacccaatgaagagtttacatctagacat
agtttagaatggaagtttctgtttctagatcacagggcaccacccataatagggtatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ttggcaaaatgtcatgagcacttaatgcaatatgggaaaggcaaatcatgttattatagg
ttcctgactaaggggcaacagtggatttggcttcagactcattattatatcacttaccat
cagtggaattcaaggccagagtttattgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtcagataatcgtataaacacagtcagtctcaaggaagca
ttggaaaggtttgatcacagcccaaccccttctgcctcttctcggagttcaagaaaatca
tctcacacggccgtctcagacccttcctcaacaccaaccaagatcccgacggatacgagc
actccgcccaggcagcatttaccagctcatgagaagatggtgcaaagaaggtcatcattt
agtagtcagtccataaattcccagtctgttggttcatcattaacacagccagtgatgtct
caagctacaaatttaccaattccacaaggcatgtcccagtttcagttttcagctcaatta
ggagccatgcaacatctgaaagaccaattggaacaacggacacgcatgatagaagcaaat
attcatcggcaacaagaagaactaagaaaaattcaagaacaacttcagatggtccatggt
caggggctgcagatgtttttgcaacaatcaaatcctgggttgaattttggttccgttcaa
ctttcttctggaaattcatctaacatccagcaacttgcacctataaatatgcaaggccaa
gttgttcctactaaccagattcaaagtggaatgaatactggacacattggcacaactcag
cacatgatacaacaacagactttacagagtacatcaactcagagtcaacaaaatgtactg
agtgggcacagtcagcaaacatctctacccagtcagacacagagcactcttacagcccca
ctgtataacactatggtgatttctcagcctgcagccggaagcatggtccagattccatct
agtatgccacaaaacagcacccagagtgctgcagtaactacattcactcaggacaggcag
ataagattttctcaaggtcaacaacttgtgaccaaattagtgactgctcctgtagcttgt
ggggcagtcatggtacctagtactatgcttatgggccaggtggtgactgcatatcctact
tttgctacacaacagcaacagtcacagacattgtcagtaacgcagcagcagcagcagcag
cagagctcccaggaacagcagctcacttcagttcagcaaccgtctcaggctcagctgacc
cagccaccgcaacaatttttacagacttctaggttgctccatgggaatccctcaactcaa
ctcattctctctgctgcatttcctctacaacaaagcaccttccctcagtcacatcaccag
caacatcagtctcagcaacagcagcaactcagccggcacaggactgacagcttgcccgac
ccttccaaggttcaaccacagtag

DBGET integrated database retrieval system