KEGG   Pan troglodytes (chimpanzee): 462491Help
Entry
462491            CDS       T01005                                 

Definition
(RefSeq) histone H1.4
  KO
K11252  histone H2B
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr05034  Alcoholism
ptr05203  Viral carcinogenesis
ptr05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    462491
  Immune diseases
   05322 Systemic lupus erythematosus
    462491
  Substance dependence
   05034 Alcoholism
    462491
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    462491
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   462491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Linker_histone
Motif
Other DBs
NCBI-GeneID: 462491
NCBI-ProteinID: XP_003311099
Ensembl: ENSPTRG00000017811
Position
6
AA seq 219 aa AA seqDB search
MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLA
ALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKA
KKAGAAKAKKPAGAAKKPKKATGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKAAK
PKKAPKSPAKAKAVKPKAAKPKTAKPKAAKPKKAAAKKK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagactgcgcctgccgcgcccgctgctccggcccctgccgagaagactcccgtg
aagaagaaggcccgcaagtctgcaggtgcggccaagcgcaaagcgtctgggcccccggtg
tccgagctcattactaaagctgttgccgcttccaaggagcgcagcggcgtatctttggcc
gctctcaagaaagcgctggcagccgctggctatgacgtggagaagaacaacagccgcatc
aagctgggtctcaaaagcctggtgagcaagggcaccctggtgcagaccaagggcaccggc
gcgtcgggttccttcaaactcaacaagaaggcggcctctggggaagccaagcctaaggct
aaaaaggcaggcgcggccaaggccaagaagccagcaggagcggcgaagaagcccaagaag
gcgacgggggcggccacccctaagaagagcgccaagaagaccccaaagaaggcgaagaag
ccggctgcagctgctggagccaaaaaagcgaaaagcccgaaaaaggcgaaagcagccaag
ccaaaaaaggcgcccaagagcccagcgaaggccaaagcagtgaaacccaaggcggctaaa
ccaaagaccgccaagcccaaggcagccaagccaaagaaggcggcagccaagaaaaagtag

DBGET integrated database retrieval system