KEGG   Pan troglodytes (chimpanzee): 462549Help
Entry
462549            CDS       T01005                                 

Gene name
GTF2H4
Definition
(RefSeq) general transcription factor IIH subunit 4
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03022  Basal transcription factors
ptr03420  Nucleotide excision repair
ptr05203  Viral carcinogenesis
Module
ptr_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    462549 (GTF2H4)
  Replication and repair
   03420 Nucleotide excision repair
    462549 (GTF2H4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    462549 (GTF2H4)
Transcription machinery [BR:ptr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     462549 (GTF2H4)
DNA repair and recombination proteins [BR:ptr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     462549 (GTF2H4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 462549
NCBI-ProteinID: NP_001038968
Ensembl: ENSPTRG00000017943
VGNC: 12635
UniProt: P60027 K7CWY8
Position
6
AA seq 462 aa AA seqDB search
MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRML
FLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRI
ALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLS
QAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQL
SFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGT
VHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGIT
AQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFEL
LLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaccccttcaaggggactgaaccgagtacacctacaatgcaggaatctgcag
gaattcttagggggcctgagccctggggtattggaccgattgtatgggcaccctgccaca
tgtctggctgtcttcagggagctcccatccttggctaagaactgggtgatgcggatgctc
tttctggagcagcctttgccacaggctgctgtagctctgtgggtaaagaaggaattcagc
aaggctcaggaggaaagtacagggctgctgagcggcctccggatctggcacacccagctg
ctcccaggcgggctccagggcctcatcctcaaccccattttccgccagaacctccgcatt
gcccttctgggtggggggaaggcctggtctgatgacacaagtcagctgggaccagacaag
catgcccgggacgttccctcccttgacaagtacgccgaggagcgatgggaggtggtcttg
cacttcatggtgggctcccccagtgcagctgtcagccaggacttggctcagctcctcagc
caggctgggctcatgaagagtactgaacctggagagccaccctgcattacttctgctggc
ttccagttcctgttgctggacaccccggctcagctctggtactttatgttgcagtatttg
cagacagcccagagccggggcatggacctggtagagattctctccttcctcttccagctc
agcttctctactctgggcaaggattactctgtggaaggtatgagtgattctctgttgaac
ttcctgcaacatctgcgtgagtttgggcttgttttccagaggaagaggaaatctcggcgt
tactaccccacacgcctggccatcaatctctcatcaggtgtctctggagctgggggcact
gtgcatcagccaggtttcattgtcgtggaaaccaattaccgactgtatgcctacacggag
tcggagctgcagattgccctcattgccctcttctctgagatgctctatcggttccccaac
atggtggtggcgcaggtgacccgggagagtgtgcagcaggcaatcgccagtggcatcaca
gcccagcagataatccatttcctaaggacaagagcccacccagtgatgctcaaacagaca
cctgtgctgccccccaccatcaccgaccagatccggctctgggagctggaaagggacaga
ctccggttcactgagggtgtcctgtataaccagttcctgtcgcaagtggactttgagttg
ctgctggcccacgcgcgggagctgggcgtgctcgtgttcgagaactcggccaagcggctc
atggtggtgaccccggccgggcacagcgacgtcaagcgcttttggaagcggcagaaacac
agctcctga

DBGET integrated database retrieval system