KEGG   Pan troglodytes (chimpanzee): 462909Help
Entry
462909            CDS       T01005                                 

Gene name
QRSL1
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial isoform X2
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00970  Aminoacyl-tRNA biosynthesis
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    462909 (QRSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ptr03029]
    462909 (QRSL1)
Enzymes [BR:ptr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     462909 (QRSL1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     462909 (QRSL1)
Mitochondrial biogenesis [BR:ptr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    462909 (QRSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 462909
NCBI-ProteinID: XP_009450043
Ensembl: ENSPTRG00000018462
Position
6
AA seq 437 aa AA seqDB search
MLKGYIPPYNATVVQKLLDQGALLMGKTNLDEFAMGSGSTDGVFGPVKNPWSYSKQYREK
RKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTGGSTRNPAAHCGLVGFKPS
YGLVSRHGLIPLVNSMDVPGILTRCVDDAAIVLGALAGPDPRDSTTVHEPINKPFMLPSL
ADVSKLCIGIPKEYLVPELSSEVQSLWSKAADLFESEGAKVIEVSLPHTSYSIVCYHVLC
TSEVASNMARFDGLQYGHRCDIDVSTEAMYAATRREGFNDVVRGRILSGNFFLLKENYEN
YFVKAQKVRRLIANDFVNAFNSGVDVLLTPTTLSEAVPYLEFIKEDNRTRSAQDDIFTQA
VNMAGLPAVSIPVALSNQGLPIGLQFIGRAFCDQQLLTVAKWFEKQVQFPVIQLQELMDD
CSAVLENEKLASVSLKQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaggttatataccaccttataatgctacagtagttcagaagttgttggatcag
ggagctctactaatgggaaaaacaaatttagatgagtttgctatgggatctgggagcaca
gatggtgtattcggaccagttaaaaacccctggagttattcaaaacaatatagagaaaag
aggaagcagaatccccacagcgagaatgaagattcagactggctgataactggaggaagc
tcaggtgggagtgcagctgctgtatcggcgttcacatgctacgcggctttaggatcagat
acaggaggatcgaccagaaatcctgctgcccactgtgggcttgttggtttcaaaccaagc
tatggcttagtttcccgtcatggtctcattcccctggtgaattcgatggatgtgccagga
atcttaaccagatgtgtggatgatgcagcaattgtgttgggtgcactggctggacctgac
cccagggactctaccacagtacatgaacctattaataaaccattcatgcttcccagtttg
gcagatgtgagcaaactatgtataggaattccaaaggaatatcttgtaccggaattatca
agtgaagtacagtctctttggtccaaagctgctgacctctttgagtctgagggggccaaa
gtaattgaagtatcccttcctcacaccagttattcaattgtctgctaccatgtattgtgc
acatcagaagtggcatcgaatatggcaagatttgatgggctacaatatggtcacagatgt
gacattgatgtgtccactgaagccatgtatgctgcaaccagacgagaagggtttaatgat
gtggtgagaggaagaattctctcaggaaactttttcttattgaaagaaaactatgaaaat
tattttgtcaaagcacagaaagtgagacgcctcattgctaatgactttgtaaatgctttt
aactctggagtagatgtcttgctaactcccaccaccttgagtgaggcagtaccatacctg
gagttcatcaaagaggacaacagaacccgaagtgcccaggatgatatttttacacaagct
gtaaatatggcaggattgccagcagtgagtatccctgttgcactctcaaaccaagggttg
ccaataggactgcagtttattggacgtgcgttttgtgaccagcagcttcttacagtagcc
aaatggtttgaaaaacaagtacagtttcctgttattcaacttcaagaactcatggatgat
tgttcagccgtccttgaaaatgaaaagttagcctctgtctctctaaaacagtaa

DBGET integrated database retrieval system