KEGG   Pan troglodytes (chimpanzee): 463138Help
Entry
463138            CDS       T01005                                 

Gene name
THBS2
Definition
(RefSeq) thrombospondin-2
  KO
K04659  thrombospondin 2/3/4/5
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04145  Phagosome
ptr04151  PI3K-Akt signaling pathway
ptr04510  Focal adhesion
ptr04512  ECM-receptor interaction
ptr05144  Malaria
ptr05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    463138 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    463138 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    463138 (THBS2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    463138 (THBS2)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    463138 (THBS2)
   05144 Malaria
    463138 (THBS2)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Phagocytosis
   Opsonins
    463138 (THBS2)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   463138 (THBS2)
  Exosomal proteins of colorectal cancer cells
   463138 (THBS2)
  Exosomal proteins of bladder cancer cells
   463138 (THBS2)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   463138 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC EGF_3 EGF_CA EGF cEGF Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 463138
NCBI-ProteinID: XP_024213293
Position
6
AA seq 1172 aa AA seqDB search
MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNADDLSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLTYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSLEDILSKKGCQQGQGAEINAISEN
TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTSCTCKKFKTICHQITCPPATC
ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
QMCNKRSCPVDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDI
CFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLDAAKTEKQVCEPENPCKDKTHNCH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNC
PHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDD
DNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atggtctggaggctggtcctgctggctctgtgggtgtggcccagcacgcaagctggtcac
caggacaaagacacgaccttcgaccttttcagtatcagcaacatcaaccgcaagaccatt
ggcgccaagcagttccgcgggcccgaccccggcgtgccggcttaccgcttcgtgcgcttt
gactacatcccaccggtgaacgcagatgacctcagcaagatcaccaagatcatgcggcag
aaggagggcttcttcctcacggcccagctcaagcaggacggcaagtccaggggcacgctg
ttggctctggagggccccggtctctcccagaggcagttcgagatcgtctccaatggcccc
gcggacacgctggatctcacctactggattgacggcacccggcacgtggtctccctggag
gacgtcggcctggctgactcgcagtggaagaacgtcaccgtgcaggtggctggcgagacc
tacagcttgcacgtgggctgcgacctcatagacagcttcgctctggacgagcccttctac
gagcacctgcaggcggaaaagagccggatgtacgtggccaaaggctctgccagagagagt
cacttcaggggtttgcttcagaacgtccacctagtgtttgaaaactctctggaagacatt
ctaagcaagaagggttgccagcaaggccagggagctgagatcaacgccatcagtgagaac
acagagacgctgcgcctgggtccgcatgtcaccaccgagtacgtgggccccagctcggag
aggaggcccgaggtgtgcgaacgctcgtgtgaggagctgggaaacatggtccaggagctc
tcggggctccacgtcctcgtgaaccagctcagcgagaacctcaagagagtgtcgaatgat
aaccagtttctctgggagctcatcggtggccctcctaagacaaggaacatgtcagcttgc
tggcaggatggccggttctttgcggaaaatgaaacgtgggtggtggacagctgcacctcg
tgtacctgcaagaaatttaaaaccatttgccaccaaatcacctgcccgcctgcaacctgc
gccagtccgtcctttgtggaaggcgaatgctgcccttcctgcctccactcggtggacggt
gaggagggctggtctccgtgggcagagtggacccagtgctctgtgacgtgtggctctggg
acccagcagagaggccggtcctgtgacgtcaccagcaacacctgcttggggccctccatc
cagacacgggcttgcagtctgagcaagtgtgacacccgcatccggcaggacggcggctgg
agccactggtcaccttggtcttcatgctctgtgacctgtggagttggcaatatcacacgc
atccgtctctgcaactccccagtgccccagatggggggcaagaattgcaaagggagtggc
cgggagaccaaagcctgccagggcgccccatgcccaatcgatggccgctggagcccctgg
tccccgtggtcggcctgcactgtcacctgtgccggtgggatccgggagcgcacccgggtc
tgcaacagccctgagcctcagtacggagggaaggcctgcgtgggggatgtgcaggagcgt
cagatgtgcaacaagaggagctgccccgtggatggctgtttatccaacccctgcttcccg
ggagcccagtgcagcagcttccccgatgggtcctggtcatgcggctcctgccctgtgggc
ttcttgggcaatggcacccactgtgaggacctggacgagtgtgccctggtccccgacatc
tgcttctccaccagcaaggtgcctcgctgtgtcaacactcagcccggcttccactgcctg
ccctgcccgccccgatacagagggaaccagcccgtcggggtcggcctggacgcagccaag
acggaaaagcaagtgtgtgagcccgaaaacccatgcaaggacaagacacacaactgccac
aagcacgcggagtgcatctacctgggccacttcagcgaccccatgtacaagtgcgagtgc
cagacaggctacgcgggcgacgggctcatctgcggggaggactcggacctggacggctgg
cccaacctcaatctggtctgcgccaccaacgccacctaccactgcatcaaggataactgc
ccccatctgccaaattctgggcaggaagactttgacaaggacgggattggcgatgcctgt
gatgatgacgatgacaatgacggtgtgaccgatgagaaggacaactgccagctcctcttc
aatccccgccaggctgactatgacaaggatgaggttggggaccgctgtgacaactgccct
tacgtgcacaaccctgcccagatcgacacagacaacaatggagagggtgacgcctgctcc
gtggacattgatggggacgatgtcttcaatgaacgagacaattgtccctacgtctacaac
actgaccagagggacacggatggtgacggtgtgggggatcactgtgacaactgccccctg
gtgcacaaccctgaccagaccgacgtggacaatgaccttgttggggaccagtgtgacaac
aacgaggacatagatgatgacggccaccagaacaaccaggacaactgcccctacatctcc
aacgccaaccaggctgaccatgacagagacggccagggcgacgcctgtgaccccgatgat
gacaacgatggcgtccccgatgacagggacaactgccggcttgtgttcaacccagaccag
gaggacttggacggtgatggacggggtgatatttgtaaagatgattttgacaatgacaac
atcccagatattgatgatgtgtgtcctgaaaacaatgccatcagtgagacagacttcagg
aacttccagatggtccccttggatcccaaagggaccacccaaattgatcccaactgggtc
attcgccatcaaggcaaggagctggttcagacagccaactcggaccctggcatcgctgta
ggttttgacgagtttgggtctgtggacttcagtggcacattctacgtaaacactgaccgg
gacgacgactatgcaggcttcgtctttggttaccagtcaagcagccgcttctatgtggtg
atgtggaagcaggtgacgcagacctactgggaggaccagcccacgcgggcctatggctac
tccggcgtgtccctcaaggtggtgaactccaccacagggacgggcgagcacctgaggaac
gcgctgtggcacacggggaacacgccggggcaggtgcgaaccttatggcacgaccccagg
aacattggctggaaggactacacggcctataggtggcacctgactcacaggcccaagacc
ggctacatcagagtcttagtgcatgaaggaaaacaggtcatggcagactcaggacctatc
tatgaccaaacctacgctggcgggcggctgggtctatttgtcttctctcaagaaatggtc
tatttctcagacctcaagtacgaatgcagagatatttaa

DBGET integrated database retrieval system