KEGG   Pan troglodytes (chimpanzee): 463278
Entry
463278            CDS       T01005                                 

Gene name
AHR
Definition
(RefSeq) aryl hydrocarbon receptor isoform X2
  KO
K09093  aryl hydrocarbon receptor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04659  Th17 cell differentiation
ptr04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    463278 (AHR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    463278 (AHR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    463278 (AHR)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    463278 (AHR)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_4 PAS_9 LexA_DNA_bind
Other DBs
NCBI-GeneID: 463278
NCBI-ProteinID: XP_003318385
Ensembl: ENSPTRG00000018955
VGNC: 4253
UniProt: H2QU80
Position
7
AA seq 850 aa
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQTVVCYNPDQLPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIATQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF
PAIMDPLPLRTKNGTSGKDSATTSTLNKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGNDTILKHEQIDQPQDGNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIKHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLQLEQQQQQQHHQKQIVVEPQQQLCQKMKHMQVNGMFENWNSNQ
FVPFSCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELD
YPMGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEP
QHTHVGQMQCNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARP
FPDLTSSGFL
NT seq 2553 nt   +upstreamnt  +downstreamnt
atgaacagcagcagcgccaacatcacctacgccagtcgcaagcggcggaagccggtacag
aaaacagtaaagccaatcccggctgaaggaatcaagtcaaatccttccaagcggcataga
gaccgacttaatacagagttggaccgtttggctagcctgctgcctttcccacaagatgtt
attaataagttggacaaactttcagttcttaggctcagcgtcagttacctgagagccaag
agcttctttgatgttgcattaaaatcctcccctactgaaagaaacggaggccaggataac
tgtagagcagcaaatttcagagaaggcctgaacttacaagaaggagaattcttattacag
gctctgaatggttttgtattagttgtcactacagatgctttggtcttttatgcttcttct
actatacaagattatctagggtttcagcagtctgatgtcatacatcagagtgtatatgaa
cttatccatactgaagaccgagctgaatttcagcgtcagctacactgggcattaaatcct
tctcagtgtacagagtctggacaaggaattgaagaagccactggtctcccccagacagta
gtctgttataacccagaccagcttcctccagaaaactctcctttaatggagaggtgcttc
atatgtcgtctaaggtgtctgctggataattcatctggttttctggcaatgaatttccaa
gggaagttaaagtatcttcatggacagaaaaagaaagggaaagatggatcaatacttcca
cctcagttggctttgtttgcgatagctactccacttcagccaccatccatacttgaaatc
cggaccaaaaattttatctttagaaccaaacacaaactagacttcacacctattggttgt
gatgccaaaggaagaattgttttaggatatactgaagcagagctgtgcacgagaggatca
ggatatcagtttattcatgcagctgatatgctttattgtgccgagtcccatatccgaatg
attaagactggagaaagtggcatgatagttttccggcttcttacaaaaaacaatcgatgg
acttgggtccagtctaatgcacgcctgctttataaaaatggaagaccagattatatcatt
gcaactcagagaccactaacagatgaggaaggaacagagcatttacgaaaacgaaatacg
aagttgccttttatgtttaccactggagaagctgtgttgtatgaggcaaccaaccctttt
cctgccataatggatcccttaccactaaggactaaaaatggcactagtggaaaagactct
gctaccacatcaactctaaacaaggattctctcaatcctagttccctcctggctgccatg
atgcaacaagatgagtctatttatctctatcctgcttcaagtacttcaagtactgcacct
tttgaaaacaatttttttaacgaatctatgaatgaatgcagaaattggcaagataatact
gcaccgatgggaaatgatactatcctgaaacatgagcaaattgaccagcctcaggatggg
aactcatttgctggaggtcacccagggctctttcaagatagtaaaaacagtgacttgtac
agcataatgaaaaacctaggcattgattttgaagacatcaaacacatgcagaatgaaaaa
tttttcagaaatgatttttctggtgaggttgacttcagagacattgacttaacggatgaa
atcctgacgtatgtccaagattctttaagtaagtctcccttcataccttcagattatcaa
cagcaacagtccttggctctgaactcaagctgtatggtacaggaacacctacagctagaa
cagcaacagcaacagcagcatcaccaaaagcaaatagtagtggagccacagcaacagctg
tgtcagaaaatgaagcacatgcaagttaatggcatgtttgaaaattggaactctaaccaa
ttcgtgcctttcagttgtccacagcaagacccacaacaatataatgtctttacagactta
catgggatcagtcaagagttcccctacaaatctgaaatggattctatgccttatacacag
aactttatttcctgtaatcagcctgtattaccacaacattccaaatgtacagagctggac
taccctatggggagttttgaaccatccccataccccactacttctagtttagaagatttt
gtcacttgtttacaacttcctgaaaaccaaaagcatggattaaatccacagtcagccata
ataactcctcagacatgttatgctggggccgtgtcgatgtatcagtgccagccagaacct
cagcacacccacgtgggtcagatgcagtgcaatccagtactgccaggccaacaggcattt
ttaaacaagtttcagaatggagttttaaatgaaacatatccagctgaattaaataacata
aataacactcagactaccacacatcttcagccacttcatcatccgtcagaagccagacct
tttcctgatttgacatccagtggattcctgtaa

DBGET integrated database retrieval system