KEGG   Pan troglodytes (chimpanzee): 465904Help
Entry
465904            CDS       T01005                                 

Gene name
MTM1
Definition
(RefSeq) myotubularin isoform X1
  KO
K01108  myotubularin [EC:3.1.3.64 3.1.3.95]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00562  Inositol phosphate metabolism
ptr01100  Metabolic pathways
ptr04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    465904 (MTM1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    465904 (MTM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptr01009]
    465904 (MTM1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     465904 (MTM1)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     465904 (MTM1)
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    465904 (MTM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase 3-PAP Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 465904
NCBI-ProteinID: XP_016799897
Position
X
AA seq 618 aa AA seqDB search
MASASTSKYNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYICPFNGPIK
GRVYITNYRLYLRSLETLSSHWRFEVDTCLFQDSSLILDVPLGVISRIEKMGGATSRGEN
SYGLDITCKDMRNLRFALKQEGHSRRDMFEILTRYAFPLAHSLPLFAFLNEEKFNVDGWT
VYNPVEEYRRQGLPNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRI
PVLSWIHPENKTVIVRCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNA
VANKATGGGYESDDAYHNAELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTH
WLEHIKLVLTGAIQVADKVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEI
LVQKEWISFGHKFASRIGHGDKNHTDADRSPIFLQFIDCVWQMSKQFPTAFEFNEQFLII
ILDHLYSCRFGTFLFNCESARERQKVTERTVSLWSLINSNKEKFKNPFYTKEINRVLYPV
ASMRHLELWVNYYIRWNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDP
PTSPSSPSQMMPHVQTHF
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgcatcaacttctaaatataattcacactccttggagaatgagtctattaag
aggacgtctcgagatggagtcaatcgggatctcactgaggctgttcctcgacttccggga
gaaacactaatcactgacaaagaagttatttacatatgtcctttcaatggccccattaag
ggaagagtttacatcacaaattatcgtctttatttaagaagtttggaaacgctgtcatct
cactggcgttttgaagtggacacctgtttgtttcaggattcttctctaatacttgatgtt
cctctgggtgtgatctcgagaattgaaaaaatgggaggcgcgacaagtagaggagaaaat
tcctatggtctagatattacttgtaaagacatgagaaacctgaggttcgctttgaaacag
gaaggccacagcagaagagatatgtttgagatcctcacgagatacgcgtttcccctggct
cacagtctgccattatttgcatttttaaatgaagaaaagtttaacgtggatggatggaca
gtttacaatccagtggaagaatacaggaggcagggcttgcccaatcaccattggagaata
acttttattaataagtgctatgagctctgtgacacttaccctgctcttttggtggttccg
tatcgtgcctcagatgatgacctccggagagttgcaacttttaggtcccgaaatcgaatt
ccagtgctgtcatggattcatccagaaaataagacggtcattgtgcgttgcagtcagcct
cttgtcggtatgagtgggaaacgaaataaagatgatgagaaatatctcgatgttatcagg
gagactaataaacaaatttctaaactcaccatttatgatgcaagacccagcgtaaatgca
gtggccaacaaggcaacaggaggaggatatgaaagtgatgatgcatatcataacgccgaa
cttttcttcttagacattcataatattcatgttatgcgggaatctttaaaaaaagtgaag
gacattgtttatcctaatgtagaagaatctcattggttgtccagtttggagtctactcat
tggttagaacatatcaagctcgttttgacaggagccattcaagtagcagacaaagtttct
tcagggaagagttcagtgcttgtgcattgcagtgacggatgggacaggactgctcagctg
acatccttggccatgctgatgttggatagcttctataggagcattgaagggttcgaaata
ctggtacaaaaagaatggataagttttggacataaatttgcatctcgaataggtcatggt
gataaaaaccacaccgatgctgaccgttctcctatttttctccagtttattgattgtgtg
tggcaaatgtcaaaacagttccctacagcttttgaattcaatgaacaatttttgattata
attttggatcatctgtatagttgccgatttggtactttcttattcaactgtgaatctgct
cgagaaagacagaaggttacagaaaggactgtttctttatggtcactgataaacagtaat
aaagaaaaattcaaaaaccccttctatactaaagaaatcaatcgagttttatatccagtt
gccagtatgcgtcacttggaactctgggtgaattactacattagatggaaccccaggatc
aagcaacaacagccgaatccagtggagcagcgttacatggagctcttagccttacgcgac
gaatacataaagcggcttgaggaactgcagctcgccaactctgccaagctttctgatccc
ccaacttcaccttccagtccttcgcaaatgatgccccatgtgcaaactcacttctga

DBGET integrated database retrieval system