KEGG   Pan troglodytes (chimpanzee): 466181Help
Entry
466181            CDS       T01005                                 

Gene name
ERLIN1
Definition
(RefSeq) erlin-1 isoform X1
  KO
K23341  erlin
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ptr04121]
    466181 (ERLIN1)
Ubiquitin system [BR:ptr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    466181 (ERLIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Catalase-rel DUF4346 Ribosomal_L33
Motif
Other DBs
NCBI-GeneID: 466181
NCBI-ProteinID: XP_001167929
Ensembl: ENSPTRG00000002841
VGNC: 3843
UniProt: H2Q2F0
Position
10
AA seq 348 aa AA seqDB search
MNMTQARVLVAAVVGLVAVLLYASIHKIEEGHLAVYYRGGALLTSPSGPGYHIMLPFITT
FRSVQTTLQTDEVKNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFN
KIHHELNQFCSAHTLQEVYIELFDQIDENLKQALQKDLNLMAPGLTIQAVRVTKPKIPEA
IRRNFELMEAEKTKLLIAAQKQKVVEKEAETERKKAVIEAEKIAQVAKIRFQQKVMEKET
EKRISEIEDAAFLAREKAKADAEYYAAHKYATSNKHKLTPEYLELKKYQAIASNSKIYFG
SNIPNMFVDSSCALKYSDIRTGRESSLPSKEALEPSGENVIQNKESTG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgactcaagcccgggttctggtggctgcagtggtggggttggtggctgtcctg
ctctacgcctccatccacaagattgaggagggccacctggctgtgtactacaggggagga
gctttactaactagccccagtggaccaggctatcatatcatgttgcctttcattactacg
ttcagatctgtgcagacaacactacaaactgatgaagttaaaaatgtgccttgtggaaca
agtggtggggtcatgatctatattgaccgaatagaagtggttaatatgttggctccttat
gcagtgtttgatatcgtgaggaactatactgcagattatgacaagaccttaatcttcaat
aaaatccaccatgagctgaaccagttctgcagtgcccacacacttcaggaagtttacatt
gaattgtttgatcaaatagatgaaaacctgaagcaagctctgcagaaagacttaaacctc
atggccccaggtctcactatacaggctgtgcgtgttacaaaacccaaaatcccagaagcc
ataagaagaaattttgagttaatggaggctgagaagacaaaactccttatagctgcacag
aaacaaaaggttgtggaaaaagaagctgagacagagaggaaaaaggcagttatagaagca
gagaagattgcacaagtggcaaaaattcggtttcagcagaaagtgatggaaaaagaaact
gaaaagcgcatttctgaaatcgaagatgctgcattcctggcccgagagaaagcgaaagca
gatgctgaatattatgctgcacacaaatatgccacctcaaacaagcacaagttgaccccg
gaatatctggagctcaaaaagtaccaggccattgcttctaacagtaagatctattttggc
agcaacatccctaacatgttcgtggactcctcatgtgctttgaaatattcagatattagg
actggaagagaaagctcactcccctctaaggaggctcttgaaccctctggagagaacgtc
atccaaaacaaagagagcacaggttga

DBGET integrated database retrieval system