KEGG   Pan troglodytes (chimpanzee): 466431Help
Entry
466431            CDS       T01005                                 

Gene name
OR5P3
Definition
(RefSeq) olfactory receptor 5P3
  KO
K04257  olfactory receptor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    466431 (OR5P3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ptr04030]
    466431 (OR5P3)
G protein-coupled receptors [BR:ptr04030]
 Others
  Chemoreception
   Olfactory
    466431 (OR5P3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 466431
NCBI-ProteinID: XP_521830
Ensembl: ENSPTRG00000003321
VGNC: 52169
UniProt: A0A2J8P660
Position
11
AA seq 311 aa AA seqDB search
MGTGNDTTVVEFTLLGLSEDTSVCAILFLVFLGIYVVTLMGNISIIVLIRRSHHLHTPMY
IFLCHLAFVDIGYSSSVTPVMLMSFLRKETSLPVAGCVAQLCSVVTFGTAECFLLAAVAY
DRYVAICSPLLYSTCMSPGVCIILVGMSYLGGCVNAWTFIGCLLRLSFCGPNKVNHFFCD
YSPLLKLACSHHFTFEIIPAISSGSIIVATVCVIAISYIYILITILKMHSTKGRHKAFST
CTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTVVIPMLNPLIYSLRNKEIKEA
LKRELRIKIFS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggggactggaaatgacaccactgtggtagagtttactcttttggggttatccgaggat
acttcagtttgtgctattttatttcttgtgtttctaggaatttatgttgtcaccttaatg
ggtaatatcagcataattgtattgatcagaagaagtcatcatcttcatacacccatgtac
attttcctctgccatttggcctttgtagacattgggtactcctcatcagtcacacctgtc
atgctcatgagcttcctaaggaaagaaacctctctccctgttgctggttgtgtggcccag
ctctgttctgtagtgacgtttggtacggccgagtgcttcctgctggctgccgtggcctat
gatcgctatgtggccatctgctcgcccctgctctactctacctgcatgtcccctggagtc
tgcatcatcttagtgggcatgtcctacctgggtggatgtgtgaatgcttggacattcatt
ggctgcttattaagactgtccttctgtgggccaaataaagtcaatcactttttctgtgac
tattcaccacttttgaagcttgcttgttcccatcattttacttttgaaataattccagct
atctcttctggatctatcattgtggccactgtgtgtgtcatagccatatcctacatctat
atcctcatcaccatcctgaagatgcactccaccaagggccgccacaaggccttctccacc
tgcacctcccacctcactgcagtcactctgttctatgggaccattaccttcatttatgtg
atgcccaagtccagctactcaactgaccagaacaaggtggtgtctgtgttctacaccgtg
gtgattcccatgttgaaccccctgatctacagcctcaggaacaaggagattaaggaggct
ctgaagagagagcttagaataaaaatattttcttga

DBGET integrated database retrieval system