KEGG   Pan troglodytes (chimpanzee): 466792Help
Entry
466792            CDS       T01005                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A-IV
  KO
K08760  apolipoprotein A-IV
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04975  Fat digestion and absorption
ptr04977  Vitamin digestion and absorption
ptr04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    466792 (APOA4)
   04979 Cholesterol metabolism
    466792 (APOA4)
   04977 Vitamin digestion and absorption
    466792 (APOA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein ApoLp-III Baculo_PEP_C YtxH DUF883 DUF1845 Gp58 KapB TEA DUF1640 Apo-CIII OmpH BshC Prominin VirE Fzo_mitofusin KMP11 Carbpep_Y_N ApoC-I
Motif
Other DBs
NCBI-GeneID: 466792
NCBI-ProteinID: XP_522192
Ensembl: ENSPTRG00000004314
VGNC: 10229
UniProt: H2Q4U2
Position
11
AA seq 396 aa AA seqDB search
MFLKAVVLTLALVAVTGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNA
LFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIRKELEELRARLLPHANEV
SQKIGDNVLELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAERMERVLRENADSLQASLR
PHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEG
LAFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQV
EEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKE
KESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggccgtggtcctgaccctggccctggtggctgtcaccggagccagggct
gaggtcagtgctgaccaggtggccacggtgatgtgggactacttcagccagctgagcaac
aatgccaaggaggccgtggaacatctccagaaatctgaactcacccagcaactcaatgcc
ctcttccaggacaaacttggagaagtgaacacttacgcaggtgacctgcagaagaagctg
gtgccctttgccaccgagctgcatgaacgcctggccaaggactcggagaaactgaaggag
gagattcggaaggagctggaggagctgagggcccggctgctgccccatgccaatgaggtg
agccagaagatcggggacaacgtgctagagcttcagcagcgcctggagccctacgcggac
cagctgcgcacccaggtcaacacgcaggccgagcagctgcggcgccagctgaccccctac
gcagagcgcatggagagagtgctgcgggagaacgccgacagcctgcaggcctcgctgagg
ccccacgccgacgagctcaaggccaagatcgaccagaacgtggaggagctcaagggacgc
cttacgccctacgccgacgaattcaaagtcaagattgaccagaccgtggaggagctgcgc
cgcagcctggctccctatgctcaggacacgcaggagaagctcaaccaccagcttgagggc
ctggccttccagatgaagaagaacgccgaggagctcaaggccaggatctcggccagtgcc
gaggagctgcggcagaggctggcgcccttggccgaggacgtgcgtggcaacctgaggggc
aacaccgaggggctgcagaagtcactggcagagctgggtgggcacctggaccagcaggtg
gaggagttccgacgccgggtggagccctacggggaaaacttcaacaaagccctggtgcag
cagatggaacagctcaggcagaagctgggcccccatgcgggggacgtggaaggccacttg
agcttcctggagaaggacctgagggacaaggtcaactccttcttcagcaccttcaaggag
aaagagagccaggacaagaccctctccctccccgagctggagcaacagcaggaacagcag
caggagcagcagcaggagcaggtgcagatgctggcccctttggagagctga

DBGET integrated database retrieval system