KEGG   Pan troglodytes (chimpanzee): 467480
Entry
467480            CDS       T01005                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptr01009]
    467480 (AKAP5)
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     467480 (AKAP5)
SSDB
Motif
Pfam: WSK NINJA_B
Other DBs
NCBI-GeneID: 467480
NCBI-ProteinID: XP_522877
Ensembl: ENSPTRG00000030719
VGNC: 12965
UniProt: A0A6D2X418 A0A2J8PIC2
Position
14
AA seq 427 aa
METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVAR
KCPQEAGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKK
AKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQ
DLSEGISRKDGDEVCESNVSNSITSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQ
DVQPQQASPLETSETDHQQPVLSDVPPLPAIPDQQIVEEASNSTLESAPNGKDYESTENV
AEETKPKDTELSQESDFKENGITEEKSKSEESKRMEPIAIIITDTEISEFDVTKSKNVPK
QFLISTENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
KINNLLQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggaaaccacaatttcagaaattcatgtagaaaacaaggatgagaagagatcagcagaa
ggtagtcctggggctgaaaggcagaaggaaaaggcatccatgctttgcttcaagagaaga
aagaaagcagccaaagcactgaagcccaaagctggctctgaagctgctgatgtggcaagg
aagtgtccacaagaagcaggagcttctgatcagccagagcccacacggggggcctgggcc
tcactcaaacgtcttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagcca
ttggagggtgaaatgcaacctgcaataaatgctgaggatgctgatctttctaagaaaaag
gcaaaatctagacttaagattccctgcataaaattcccaagagggccaaaaaggagtaat
cattccaaaattatagaagactcagactgcagcatcaaagtccaggaagaagctgaaatt
ttggatatacaaacacagaccccattgaatgatcaggcaacaaaggctaagtcaacccag
gatctaagtgaaggcatctcacggaaagatggtgatgaggtctgtgaatcaaatgtgagc
aatagcataacttctggagagaaagtgatttcagtagaacttggattagataatgggcat
tctgctattcaaacgggaactctaatccttgaagaaattgaaacgatcaaggaaaaacaa
gatgttcaaccccagcaagcaagcccacttgaaacttcagaaacagaccatcagcagcca
gtactttctgatgttcctcctttacctgcaattccagatcaacaaattgtggaagaagcc
agtaacagtaccctagaaagtgcaccaaatggaaaagactatgaaagtacagagaatgta
gctgaagaaactaagccaaaagatactgaattgagccaagaatcagattttaaagaaaat
gggatcactgaagagaaatccaaatcagaagaaagcaaaagaatggagccaattgctatt
attattacagacactgaaatcagtgaatttgatgttacaaaatctaaaaatgtccctaag
caattcttaatttcaactgaaaatgagcaagtaggggtttttgctaatgataatggtttt
gaggatagaacttcagaacaatatgaaacactcttaattgaaacagcctcttctcttgtc
aagaatgctattcagttgtcaatagaacagctggttaatgaaatggcctctgatgataat
aaaataaacaatcttctacagtga

DBGET integrated database retrieval system