KEGG   Pan troglodytes (chimpanzee): 467517Help
Entry
467517            CDS       T01005                                 

Gene name
ZDHHC22
Definition
(RefSeq) palmitoyltransferase ZDHHC22
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    467517 (ZDHHC22)
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     467517 (ZDHHC22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 467517
NCBI-ProteinID: XP_001163688
Ensembl: ENSPTRG00000039596
VGNC: 8215
UniProt: H2RG61
Position
14
AA seq 263 aa AA seqDB search
MLALRLLNVVAPAYFLCISLVTFVLQLFLFLPSMREDPAAARLFSPALLHGALFLFLSAN
ALGNYVLVIQNSPDDLGACQGASARKTPCPSPSTHFCRVCARVTLRHDHHCFFTGNCIGS
RNMRNFVLFCLYTSLACLYSMVAGVAYISAVLSISFAHPLAFLTLLPTSISQFFSGAVLG
SEMFVILMLYLWFAIGLACAGFCCHQLLLILRGQTRHQVRKGVAVRARPWRKNLQEVFGK
RWLLGLLVPMFNVGSESSKQQDK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgctggccctgaggctgctcaacgtggtggcccccgcctacttcttgtgcatctccctg
gtgaccttcgtgctgcagctcttcctcttcctgcccagcatgcgcgaggaccccgcggcc
gcccggctcttctcgcccgccctgctccacggggcgctcttcctattcctctcggccaac
gccctgggcaattacgtccttgtcatccagaactccccagacgacctgggggcctgccag
ggggcctcggccaggaagactccatgcccctcacctagcacccacttctgccgagtgtgc
gccagagtcaccctgaggcacgaccatcactgtttcttcaccggcaactgcatcggcagc
aggaacatgcgcaacttcgtcctgttctgcctctacacctccctggcctgcctctactcc
atggtggccggcgtggcctacatctccgctgtcctttccatctccttcgcccaccccttg
gccttcctcacgctcctgcccacctccatcagccagttcttctccggagctgtcctgggt
tctgaaatgttcgtcatcctcatgctctacctctggttcgccatcggcctggcctgcgcc
ggcttctgctgccaccagctgctgttgatcctccgcgggcagacccgccaccaggtgcgg
aagggggtggcagtgagggcccggccctggcgcaagaacttacaagaggtcttcggaaag
aggtggctgctgggcctgctggtccccatgttcaatgtcggaagtgagagctccaagcag
caggataagtag

DBGET integrated database retrieval system