KEGG   Pan troglodytes (chimpanzee): 467665
Entry
467665            CDS       T01005                                 

Gene name
ZNF106
Definition
(RefSeq) zinc finger protein 106 isoform X3
  KO
K24691  zinc finger protein 106
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ptr04990]
    467665 (ZNF106)
Domain-containing proteins not elsewhere classified [BR:ptr04990]
 Zinc finger domain-containing proteins
  Other zinc finger domain-containing proteins
   467665 (ZNF106)
SSDB
Motif
Pfam: WD40 BBS2_Mid WD40_like zf-C2H2_aberr WD40_2 zf-met zf-C2H2_jaz zf-C2H2_4
Other DBs
NCBI-GeneID: 467665
NCBI-ProteinID: XP_009427179
Ensembl: ENSPTRG00000006974
VGNC: 1576
UniProt: A0A6D2XLE7 H2RGE9
Position
15
AA seq 1111 aa
MVRERKCILCHIVYSSKKEMDEHMRSMLHHRELENLKGRFGIEMVPLVQNEQEALDLDGE
PDLSSLEGFQWEGVSISSSPGLARKRSLSESSVIMDRAPSVYSFFSEEGTGKENEPQQMV
SPSNSLRAGQSQKATMHLKQEVTPRAASLRTGERAENVATQRRHSAQLSSDHIIPLMHLA
KDLNSQERSIPPSENQNSQESNGEGNCLSSSASSALAISSLADAATDSSCTSGAEQNDGQ
SIRKKRRATGDGSSPELPSLERKNKRRKIKGKKERSQVDQLLNISLREEELSKSLQCMDN
NLLQARAALQTAYVEVQRLLMLKQQITMEMSALRTHRIQILQGLQETYEPSEHPDQVPCS
LTRERRNSRSQTSIDAALLPTPFFPLFLEPPSSHVSPSPTGASLQITTSPTFQTHGSVPA
PDSSVQIKQEPMSPEQDENVNAVPPSSACNVSKELLEANREISDSCPVYPVITARLSLSE
STESFHEPSQELKFSVEQRNTRNRENSPSSQSAGLSSINKEGEEPTKGNSGSEACTSSFL
RLSFASETPLEKEPHSPADQPEQQAESTLTSAETRGSKKKKKLRKKKSLRAAHVPENSDT
EQDVLTVKPVRKVKAGKLIKGGKVTTSTWEDSRTGREQESVRDEPDSDSSLEVLEIPNPQ
LEVVAIDSSESGEEKPDSPSKKDIWNSTEQNPLETSRSGCDEVSSTSEIGTRYKDGIPVS
VAETQTVISSIKGSKNSSEISSEPGDDDEPTEGSFEGHQAAVNAIQIFGNLLYTCSADKT
VRVYNLVSRKCIGVFEGHTSKVNCLLVTQTSGKNAALYTGSSDHTIRCYNVKSRECVEQL
QLEDRVLCLHSRWRILYAGLANGTVVTFNIKNNKRLEIFECHGPRAVSCLATAQEGARKL
LVVGSYDCTISVRDARNGLLLRTLEGHSKTILCMKVVNDLVFSGSSDQSVHAHNIHTGEL
VRIYKGHNHAVTVVNILGKVMVTACLDKFVRVYELQSHDRLQVYGGHKDMIMCMTIHKSM
IYTGCYDGSIQAVRLNLMQNYRCWWHGCSLIFGVVDHLKQHLLTDHTNPNFQTLKCRWKN
CDAFFTARKGSKQDAAGHIERHAEDDSKIDS
NT seq 3336 nt   +upstreamnt  +downstreamnt
atggtacgagaacgaaaatgcatattatgccacatcgtgtacagctcaaaaaaggagatg
gacgaacacatgcggagcatgttgcatcacagggaacttgagaacctcaagggcaggttt
ggcatagaaatggtaccccttgttcaaaatgaacaagaagccttagatttggatggggaa
cctgatctgtccagtctagaaggattccagtgggaaggtgtttccatttcctcgtcccct
ggcttggcaagaaagcgaagcctttctgagagcagcgtgatcatggacagagctccttct
gtgtatagcttcttcagtgaggaaggtacaggcaaagaaaatgagccccagcagatggtt
tcacctagtaactcattgagggctggacagagccagaaagcaaccatgcacctcaaacaa
gaagtgacacctcgggctgcctccctccgaacaggtgaaagggctgaaaatgttgctacc
caaaggcgacatagtgcacagttatcctctgaccatataatacctttgatgcatttggca
aaagacttgaacagccaggagaggtctataccaccttcagagaatcagaattcccaggag
agtaatggagagggaaactgtctgtcatcaagtgcatcctcagcccttgcgatctccagt
ttagcggatgcagccacagatagtagctgtacctctggtgctgaacaaaatgatggccaa
agtattagaaagaaacgaagagccactggagatggatcttctcctgaactcccaagtctt
gagagaaaaaataaaagaaggaaaattaaaggaaaaaaagaacgttctcaggttgaccag
ctgctgaatatttctttaagggaggaagaacttagtaagtcattgcagtgcatggataac
aatcttctgcaagcccgtgcagcccttcagacagcttatgtggaagttcagaggctactt
atgctcaagcagcagataactatggagatgagtgcactgaggacccatagaatacagatt
ctacagggattacaagaaacatatgaaccttctgagcacccagaccaggttccctgtagc
ctcacacgagaacgaaggaacagtagatctcaaacatccattgatgccgcactgctgccc
actccctttttcccactttttctggagcctccatcttcccatgtgtctccatcacccacc
ggagcctctcttcaaataaccacgtctcctactttccaaacccatggcagtgtccctgct
ccagactcatcagttcagattaaacaagagcccatgtctcctgaacaagatgagaatgtg
aatgctgtgccaccaagctctgcctgcaatgtgtccaaggaattactggaagctaataga
gagatcagtgacagttgtccagtttatccagtcatcactgctagattgtccttatcagag
tcaacagaaagtttccatgagcctagccaagaactgaagttttctgtggagcaaagaaat
accagaaacagagaaaactctccctcttcccaatcagctggtctttctagcataaataaa
gaaggggaagagccaaccaaaggcaatagtgggtctgaagcctgtaccagttcttttcta
agattgtcttttgcttcagaaacccctttggagaaggaaccccactctccagctgaccag
cctgaacaacaggcagaatccactttgacatcagctgagactaggggaagcaagaaaaag
aagaaacttcggaagaagaaaagtctacgggctgcccatgttcctgagaatagtgacact
gaacaggatgttttgactgttaaacctgtaaggaaagtaaaagctggaaagttaattaaa
ggggggaaagtaacaacctccacttgggaagacagcaggactggtagggagcaggagagt
gtcagagatgagccagatagtgactcgtctctggaagtcctagaaattcctaatcctcag
ttagaagtagtagccattgattcttcagaatcaggagaagagaaaccagacagcccatct
aaaaaggatatttggaactctacagagcaaaacccactagaaacgtctcgttctgggtgt
gatgaagttagctctaccagtgaaattggcactcgctataaagatggcatccctgtaagt
gtggcagaaactcagactgtgatctcctccataaaaggatcaaagaattcttcagaaata
tcttcagagccaggagatgatgatgaacccacagaaggaagctttgagggacaccaagct
gccgtaaatgcaattcagatatttgggaacttgctatatacctgttcagcagataaaact
gttcgggtttataatctggtgagtcggaaatgtattggtgtctttgagggtcatacctcc
aaagttaactgcctcctggttactcagacctctgggaagaatgctgccctttacaccggg
tccagtgaccataccatccgctgctataatgttaagagccgagagtgtgtggagcagtta
cagctggaagaccgggtcctctgcctccacagtagatggcgaatcctctatgcgggactg
gcaaatggcactgtggtcaccttcaacataaagaacaacaaacgacttgagatctttgaa
tgccatggccctcgggcagtcagctgtcttgctacagctcaggaaggtgcccgaaaactg
ctggtcgtggggtcttatgactgcacaattagtgtacgcgatgcccggaatggactgctc
ctcagaactctggagggccatagcaaaaccattctttgcatgaaggtggtgaatgatctc
gtgttcagtggctccagtgatcagtcagtccatgcccacaacattcacactggtgagctc
gtgcggatctataaaggtcacaatcatgcagtgactgtggtgaatatcctaggaaaagtg
atggtgactgcttgcctggataaatttgttcgtgtctatgaattacagtctcatgatcga
ttacaagtttatggaggacacaaagacatgattatgtgtatgaccatccataaaagcatg
atttacactggctgttatgatggcagtattcaggccgtgaggcttaatctgatgcagaat
taccgctgttggtggcatggttgctctctgatatttggcgttgtagatcatttaaaacaa
cacttgctgaccgaccacactaatcccaacttccagactctgaaatgtcgctggaagaac
tgcgatgcttttttcactgctaggaaaggatccaaacaggatgctgcaggacatattgaa
cgacatgctgaagatgacagcaaaattgattcatga

DBGET integrated database retrieval system