KEGG   Pan troglodytes (chimpanzee): 468149Help
Entry
468149            CDS       T01005                                 

Gene name
OR1A1
Definition
(RefSeq) olfactory receptor 1A1
  KO
K04257  olfactory receptor
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    468149 (OR1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ptr04030]
    468149 (OR1A1)
G protein-coupled receptors [BR:ptr04030]
 Others
  Chemoreception
   Olfactory
    468149 (OR1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 468149
NCBI-ProteinID: NP_001009115
Ensembl: ENSPTRG00000008560
VGNC: 9491
UniProt: Q9TUA7 A0A2J8KR89
Position
17
AA seq 309 aa AA seqDB search
MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVHLHNPMY
FLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAY
DRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCD
ITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTC
GSHLTVVSLYYGTVMGMYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDVKAALR
KLFNKRISS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaaataaccagtcctctacactggaattcatcctcctgggagttactggtcag
caggaacaggaagatttcttctacatcctcttcctgttcatttaccccatcacattgatt
ggaaacctgctcatcgtcctagccatttgctctgatgttcaccttcacaaccccatgtat
tttctccttgccaacctctccttggttgacatcttcttctcatccgtaaccatccctaag
atgctggccaaccatctcttgggcagcaaatccatctcttttgggggatgcctaacgcag
atgtatttcatgatagccttgggtaacacagacagctatattttggctgcaatggcatat
gatcgagctgtggccatcagccgcccacttcactacacaacaattatgagtccacggtct
tgtatctggcttattgctgggtcttgggtgattggaaatgccaatgccctcccccacact
ctgctcacagctagtctgtccttctgtggcaaccaggaagtggccaacttctactgtgac
attacccccttgctgaagttatcctgttctgacatccactttcacgtgaagatgatgtac
ctaggggttggcattttctctgtgccattactatgcatcattgtctcctatattcgagtc
ttctccacagtctttcaggttccttccaccaagggcgtgctcaaggccttctccacctgt
ggttcccacctcacggttgtctctttgtattatggtacagtcatgggcatgtatttccgc
cctttgaccaattatagcctaaaagacgcagtgatcactgtaatgtacacggcagtgacc
ccaatgttaaatcctttcatctacagtctgagaaatcgggacgtgaaggctgccctgcgg
aaactcttcaacaagagaatctcctcgtaa

DBGET integrated database retrieval system