KEGG   Pan troglodytes (chimpanzee): 468740
Entry
468740            CDS       T01005                                 

Gene name
PRDX2
Definition
(RefSeq) peroxiredoxin-2
  KO
K03386  peroxiredoxin 2/4 [EC:1.11.1.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptr04147]
    468740 (PRDX2)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     468740 (PRDX2)
Exosome [BR:ptr04147]
 Exosomal proteins
  Proteins found in most exosomes
   468740 (PRDX2)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Other DBs
NCBI-GeneID: 468740
NCBI-ProteinID: XP_016790684
Ensembl: ENSPTRG00000010541
VGNC: 2281
UniProt: H2QFG9 A0A6D2WL03
Position
19
AA seq 198 aa
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSN
RAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKT
DEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
DTIKPNVDDSKEYFSKHN
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcctccggtaacgcgcgcatcggaaagccagcccctgacttcaaggccacagcggtg
gttgatggcgccttcaaagaggtgaagctgtcggactacaaagggaagtacgtggtcctc
tttttctaccctctggacttcacttttgtgtgccccaccgagatcatcgcgttcagcaac
cgtgccgaggacttccgcaagctgggctgtgaagtgctgggcgtctcggtggactctcag
ttcacccacctggcttggatcaacaccccccggaaagagggaggcttgggccccctgaac
atccccctgcttgctgacgtgaccagacgcttgtctgaggattacggcgtgctgaaaaca
gatgagggcattgcctacaggggcctctttatcatcgatggcaagggtgtccttcgccag
atcactgttaatgatttgcctgtgggacgctccgtggatgaggctctgcggctggtccag
gccttccagtacacagacgagcatggggaagtttgtcccgctggctggaagcctggcagt
gacacgattaagcccaacgtggatgacagcaaggaatatttctccaaacacaattag

DBGET integrated database retrieval system