KEGG   Pan troglodytes (chimpanzee): 469325Help
Entry
469325            CDS       T01005                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7 precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00480  Glutathione metabolism
ptr00590  Arachidonic acid metabolism
ptr04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    469325 (GPX7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    469325 (GPX7)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    469325 (GPX7)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     469325 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA SCO1-SenC Acyl-CoA_dh_C
Motif
Other DBs
NCBI-GeneID: 469325
NCBI-ProteinID: NP_001139309
Ensembl: ENSPTRG00000000741
VGNC: 1254
UniProt: H2R0N7
Position
1
AA seq 187 aa AA seqDB search
MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFT
DQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAV
TGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLI
LLKREDL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcgacggtggcagcggcgtggctgctcctgtgggctgcggcctgcgcgcag
caggagcaggacttctacgacttcaaggcggtcaacatccggggcaaactggtgtcgctg
gagaagtaccgcggatcggtgtccctggtggtgaatgtggccagcgagtgcggcttcaca
gaccagcactaccgagccctgcagcagctgcagcgggacctgggtccccaccacttcaac
gtgctcgccttcccctgcaaccagtttggccaacaggagcctgacagcaacaaggagatt
gagagctttgcccgccgcacctacagtgtctcattccctatgtttagcaagattgcagtc
accggtactggtgcccatcctgccttcaagtacctggcccagacttctgggaaggagccc
acctggaacttctggaagtaccttgtagccccagatggaaaggtggtaggggcttgggac
ccaactgtgtcagtggaggaggtcagaccccagatcacagcgctcgtgaggaagctcatc
ctactgaagcgagaagacttataa

DBGET integrated database retrieval system