KEGG   Pan troglodytes (chimpanzee): 469866
Entry
469866            CDS       T01005                                 
Symbol
SIGLEC1
Name
(RefSeq) sialoadhesin
  KO
K06548  sialoadhesin
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    469866 (SIGLEC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptr04090]
    469866 (SIGLEC1)
   04091 Lectins [BR:ptr04091]
    469866 (SIGLEC1)
CD molecules [BR:ptr04090]
 Proteins
  469866 (SIGLEC1)
Lectins [BR:ptr04091]
 I-type lectins (Siglecs)
  469866 (SIGLEC1)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set ig V-set C2-set_2 Ig_4 C1-set Ig_5 Izumo-Ig BiPBP_C
Other DBs
NCBI-GeneID: 469866
NCBI-ProteinID: XP_016792863
Ensembl: ENSPTRG00000013201
VGNC: 9977
UniProt: A0A6D2Y5I7 H2QJW1
Position
20:complement(4082563..4108369)
AA seq 1709 aa
MGFLPKLLLLASFFPAGQASWGVSSPQDVQGVKGSCLLIPCIFSFPADVEVPDGITTIWY
YDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEIT
EVNRWSDVKGTLVTVTEEPRVPTIASPVELLEGTEVDFNCSTPYACLQEQVRLQWQGQDP
ARSVTFNSQKFEPTGVGHLETLHMAMSWQDHGRILRCQLSVANHRAQSEIHLQVKYAPKG
VKILLSPSGRNILPGELVTLTCQVNSSYPAVSSIKWFKDGVRLQTKTGVLHLPQAAWSDA
GVYTCQAENGVGSLVSPPISLHIFMAEVQVSPAGPILENQTVTLVCNTPNEAPSDLRYSW
YKNHVLLEDAHSHTLRLHLATRADTGFYFCEVQNVHGSERSGPVSVVVNHPPLTPVLTAF
LETQAGLVGILHCSVVSEPLATLVLSHGGHILASTSGDSDHSPRFSGTSGPNSLRLEIRD
LEETDSGEYKCSATNSLGNATSTLDFHANAARLLISPAAEVVEGQAVTLSCRSGLSPTPD
ARFSWYLNGALLHEGPGSSLLLPAASSADAGSYHCRARDGHSASGPSSPAVLTVLYPPRQ
PTFTTRLDLDAAGAGAGRRGLLLCRVDSDPPARLQLLHKDRVVATSLLSGGGCSTCGGCS
PRMKVTKAPNLLRVEIHNPLLEEEGLYLCEASNALGNASTSATFNGQATVLVIAPSHTLQ
EGTEANLTCNVSREAAGSPANFSWFRNGALWAQGPLETVTLLPVARTDAALYACRILTEA
GAQLSTPVLLSVLYPPDPPKLSALLDMGQGHMALFICTVDSRPLALLALFHGEHLLATSL
GPQVPSHGRFQAKAEANSLKLEVRELGLGDSGSYRCEATNVLGSSNTSLFFQVRGAWVQV
SPSPELQEGQAVVLSCQVPTGVPEGTSYRWYRDGQPLQESTSATLRFAAITLTQAGAYHC
QAQAPGSATTSLAAPISLHVSYAPRHVTLTTLMDTGPGRLGLLLCRVDSDPPAQLRLLHG
DRLVASTLRGVGGPEGSSPRLQVAVAPNTLRLEIHGAMLEDEGVYICEASNTLGQASASA
DFDAQAVNVQVWPGATVQEGQLVNLTCLVWTTHPAQLTYTWYQDGQQRLDAHSIPLPNVT
VRDATSYRCGVGPPGQAPRLSRPITLDVLYAPRNLRLTYLLESHGGQLALLLCTVDSRPP
AQLALSHAGRLLASSTAASVPNTLRLELREPQPSDEGFYSCSARSPLGQANTSLELRLEG
VRVILAPEATVPEGAPITVTCEDPAARAPTLYTWYHNGRWLQEGPAASLSFLVATRAHAG
AYSCQAQDAQGTRSSRPAALQVLYAPQDAVLSSFRDSRARSMAVIQCTVDSEPPAELALS
HDGKVLATSSGVHSLASGTGHVQVARNALRLQVQDVPAGDDTYVCTAQNLLGSISTIGRL
QVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPLPTLAFTH
VARAQAGMYHCLAELPTGAAASAPVMLRVLYPPKTPTMMVFVEPEGGLRGILDCRVDSEP
LASLTLHLGSRLVASSQPQGAPAEPHIHVLASPNALRVDIEALRPSDQGEYVCSASNVLG
SASTSTYFGVRALHRLHQFQQLLWVLGLLVGLLLLLLGLGACYTWRRRRVCKQSMGENSV
EMAFQKETTQLIDPDAATCETSTCAPPLG
NT seq 5130 nt   +upstreamnt  +downstreamnt
atgggcttcttgcccaagcttctcctcctggcctcattcttcccagcaggccaggcctca
tggggcgtctccagtccccaggacgtgcagggtgtgaaggggtcttgcctgcttatcccc
tgcatcttcagcttccctgccgacgtggaggtgcccgacggcatcacgaccatctggtac
tacgactactcgggccagcggcaggtggtgagccactcggcggaccccaagctggtggag
gcccgcttccgcggccgcaccgagttcatggggaaccccgagcacagggtgtgcaacctg
ctgctgaaggacctgcagcccgaggactctggctcctacaacttccgcttcgagatcact
gaggtcaaccgctggtcagatgtgaaaggcaccttggtcacagtaacagaggagcccagg
gtgcccaccattgcctccccggtggagcttctcgaaggcacagaggtggacttcaactgc
tccactccctacgcatgcctgcaggagcaggtcagactgcagtggcaaggccaggaccct
gctcgctctgtcaccttcaacagccagaagtttgagcccaccggcgtcggccacctggag
accctccacatggccatgtcctggcaggaccacggccggatcctgcgctgccagctctct
gtggccaatcacagggctcagagcgagattcacctccaagtgaagtatgcccccaagggt
gtgaagatcctcctcagcccctcggggaggaacatccttccaggtgagctggtcacactc
acctgccaggtgaacagcagctaccctgcagtcagttccattaagtggttcaaggatggg
gtacgcctccaaaccaagactggtgtgctgcacctgccccaggcagcctggagcgatgct
ggcgtctacacctgccaagctgagaatggcgtgggctctttggtctcaccccccatcagc
ctccacatcttcatggctgaggtccaggtgagcccagcaggtcccatcctggagaaccag
acagtgacactagtctgcaacacacccaacgaggcacccagcgatctccgctacagctgg
tacaagaaccatgtcctgctggaggatgcccactcccataccctccggctgcacttggcc
actagggctgatactggcttctacttctgtgaggtgcagaacgtccatggcagcgagcgc
tcgggccctgtcagcgtggtagtcaaccacccgcctctcaccccagtcctgacagccttc
ctggagacccaggcaggacttgtgggcatccttcactgctctgtggtcagtgagcccctg
gccacactggtgctgtcacatgggggtcatatcctggcctccacctccggggacagtgat
cacagcccacgcttcagtggtacctctggtcccaactccctgcgcctggagatccgagac
ctggaggaaactgacagtggggagtacaagtgctcagccaccaactcccttggaaatgca
acctccaccctggacttccatgccaatgccgcccgtctcctcatcagcccggcagccgag
gtggtggaaggacaggcagtgacactgagctgcagaagcggcctgagccccacacctgat
gcccgcttctcctggtacctgaatggagccctgcttcacgagggtcccggcagcagcctc
ctgctccccgcggcctccagcgctgacgccggctcataccactgccgggcccgggacggc
cacagtgccagtggcccctcttcgccagctgttctcactgtgctctacccccctcgacaa
ccaacattcaccaccaggctggaccttgatgccgctggggccggggctggacggcgaggc
ctccttttgtgccgtgtggacagcgacccccccgccaggctgcagctgctccacaaggac
cgtgttgtggccacttccctgctgtcagggggtggctgcagcacctgtgggggctgttcc
ccacgcatgaaggtcaccaaagcccccaacttgctgcgtgtggagattcacaaccctttg
ctggaagaggagggcttgtacctctgtgaggccagcaatgccctgggcaacgcctccacc
tcagccaccttcaatggccaggccactgtcctggtcattgcaccatcacacacgcttcag
gagggcacagaagccaacttgacttgcaacgtgagccgggaagctgctggcagccctgct
aacttctcctggttccgaaatggggcgctgtgggcccagggtcccctggagaccgtgaca
ctgctgcccgtggccagaactgatgctgccctttacgcctgccgcatcctgactgaggct
ggtgcccagctctccactcccgtgctcctgagtgtactctatcccccggaccctccaaag
ctgtcagccctcctagacatgggccagggccacatggctctgttcatctgcactgtggac
agccgccccctggccttgctggccctgttccatggggagcacctcctggccaccagcctg
ggtccccaggtcccatcccacggtcggttccaggctaaggctgaggccaactccctgaag
ttagaggtccgagaactgggccttggggactctggcagctaccgctgtgaggccacaaat
gttcttggatcatccaacacctcactcttcttccaggtccgaggagcctgggtccaggtg
tcaccatcacctgagctccaagagggccaggctgtggtcctgagctgccaggtacccaca
ggagtcccagaggggacctcatatcgttggtatcgggatggccagcccctccaggagtcg
acctcggccacgctccgctttgcagccataactttgacacaagctggggcctatcattgc
caagcccaggccccaggctcagccaccacgagcctagctgcacccatcagcctccacgtg
tcctatgccccacgccacgtcacactcactaccctgatggacacaggccctgggcgactg
ggcctcctcctgtgccgtgtggacagtgaccctccggcccagctgcggctgctccacggg
gaccgccttgtggcctccaccctacgaggtgtggggggacccgaaggcagctctcccagg
ctgcaggtggctgtggcccccaacacactgcgtctggagatccacggggcaatgctggag
gatgagggtgtctatatctgtgaggcctccaacaccctgggccaggcctcggcctcagct
gacttcgacgctcaagctgtgaatgtgcaggtgtggcccggggctaccgtgcaggagggg
cagctggtgaacctgacctgccttgtgtggaccactcacccggcccagctcacctacaca
tggtaccaggatgggcagcagcgcctggatgcccactccatccccctgcccaacgtcaca
gtcagggatgccacctcctaccgctgtggtgtgggcccccctggtcaggcaccccgccta
tccagacctatcaccttggacgtcctctacgcgccccgcaacctgcgcctgacctacctc
ctggagagccatggtgggcagctggccctgctactgtgcactgtggacagccgcccacct
gcccagctggccctcagccacgccggtcgcctcttggcctcctcgacagcagcctctgtc
cccaacaccctgcgcctggagctgcgggagccacagcccagtgacgagggtttctacagc
tgctctgcccgcagccctctgggccaggccaacacgtccctggagctgcggctggagggt
gtgcgggtgatcctggctccagaggctaccgtgcctgaaggtgcccccatcacagtgacc
tgtgaggaccctgctgcccgcgcacccaccctctatacctggtaccacaatggtcgttgg
ctgcaggagggtccagctgcctcactctcattcctggtggccacgcgggctcatgcaggc
gcctactcttgccaggcccaggatgcccagggcacccgcagctcccgtcctgctgccctg
caagtcctctatgcccctcaggacgctgtcctgtcctccttccgggactccagggccaga
tccatggctgtgatacagtgcactgtggacagtgagccacctgctgagctggccctatct
catgatggcaaggtgctggccacgagcagtggggtccacagcttggcatcagggacaggc
catgtccaggtggcccgaaacgccctacggctgcaggtgcaagatgtgcctgcaggtgat
gacacctatgtttgcacagcccaaaacttgctgggctcaatcagcaccatcgggcggttg
caggtagaaggtgcacgcgtggtggcagagcctggcctggacgtgcctgagggcgctgcc
ctgaacctcagctgccgcctcctgggtggccctgggcctgtgggcaactccacctttgca
tggttctggaatgaccggcggctgcacgcggagcctctgcccactctcgccttcacccac
gtggctcgtgctcaagctgggatgtaccactgcctggctgagctccccactggggctgct
gcctctgctccagtcatgctccgtgtgctctaccctcccaagacgcccaccatgatggtc
ttcgtggagcctgagggtggcctccggggcatcctggattgccgagtggacagcgagccg
ctcgccagcctgactctccaccttggcagtcgactggtggcctccagtcagccccagggt
gctcctgcagagccacacatccatgtcctggcttcccccaatgccctgagggtggacatc
gaggcgctgaggcccagcgaccaaggggaatacgtgtgttctgcctcaaatgtcctgggc
tctgcctctacctccacctactttggggtcagagccctgcaccgcctgcatcagttccag
cagctgctctgggtcctgggactgctggtgggcctcctgctcctgctgttgggcctgggg
gcctgctacacctggagaaggaggcgtgtttgtaagcagagcatgggcgagaattcggtg
gagatggcttttcagaaagagaccacgcagctcattgatcctgatgcagccacatgtgag
acctcaacctgtgccccacccttgggctga

DBGET integrated database retrieval system