KEGG   Pan troglodytes (chimpanzee): 470253Help
Entry
470253            CDS       T01005                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00071  Fatty acid degradation
ptr01212  Fatty acid metabolism
ptr03320  PPAR signaling pathway
ptr04152  AMPK signaling pathway
ptr04714  Thermogenesis
ptr04920  Adipocytokine signaling pathway
ptr04922  Glucagon signaling pathway
ptr04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    470253 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    470253 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    470253 (CPT1B)
   04920 Adipocytokine signaling pathway
    470253 (CPT1B)
   03320 PPAR signaling pathway
    470253 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    470253 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    470253 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ptr03029]
    470253 (CPT1B)
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     470253 (CPT1B)
Mitochondrial biogenesis [BR:ptr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    470253 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 470253
NCBI-ProteinID: XP_009436968
Ensembl: ENSPTRG00000014548
VGNC: 5976
UniProt: H2R3K5
Position
22
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVIMATVGSSFCNVDVSLGLVSCIQRCLPQGCGPYQTPQTRALLSMAIFSTGVWVTG
IFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRHPMLYTFQTSLPKLPVPR
VSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSWWASNYVSDWWEE
YIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDL
EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA
LDEESYCYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCL
YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIHMFDPEQHPNHLGAGGGFGPVADDGY
GVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagctcaccaggccgtggccttccagttcacggtgaccccagacggggtcgac
ttccggctcagtcgggaggccctgaaacacgtctacctgtctgggatcaactcctggaag
aaacgcctgatccgcatcaagaatggcatcctcaggggcgtgtaccctggcagccccacc
agctggctggtcgtcatcatggcaacagtgggttcctccttctgcaacgtggacgtctcc
ttggggctggtcagttgcatccagagatgcctccctcaggggtgtggcccctaccagacc
ccgcagacccgggcacttctcagcatggccatcttctccacgggcgtctgggtgacgggc
atcttcttcttccgccaaaccctgaagctgcttctctgctaccatgggtggatgtttgag
atgcatggcaagaccagcaacttgaccaggatctgggctatgtgtatccgccttctatcc
agccggcaccctatgctctacaccttccagacatctctgcccaagcttcctgtgcccagg
gtgtcagccacaattcagcggtacctagagtctgtgcgccccttgttggatgatgaggaa
tattaccgcatggagttgctggccaaagaattccaggacaagactgcccccaggctgcag
aaatacctggtgctcaagtcatggtgggcaagtaactatgtgagtgactggtgggaagag
tacatctaccttcgaggcaggagccctctcatggtgaacagcaactattatgtcatggac
cttgtgctcatcaagaatacagacgtgcaggcagcccgcctgggaaacatcatccacgcc
atgatcatgtatcgccgtaaactggaccgtgaagaaatcaagcctgtgatggcactgggc
atagtgcccatgtgctcctaccagatggagaggatgttcaacaccactcggatcccgggc
aaggacacagatgtgctacagcacctctcagacagccggcacgtggctgtctaccacaag
ggacgcttcttcaagctgtggctctatgagggcgcccgtctgctcaagcctcaggatctg
gagatgcagttccagaggatcctggacgacccctccccacctcagcctggggaggagaag
ctggcagccctcactgcaggaggaagggtggagtgggcgcaggcacgccaggccttcttt
agctctggaaagaataaggctgccttggaggccatcgagcgtgccgctttcttcgtggcc
ctggatgaggaatcctactgctatgaccccgaagatgaggccagcctcagcctctatggc
aaggccctgctacatggcaactgctacaacaggtggtttgacaaatccttcactctcatt
tccttcaagaatggccagttgggtctcaatgcagagcatgcgtgggcagatgctcccatc
attgggcacctctgggagtttgtcctgggcacagacagcttccacctgggctacacggag
accgggcactgcctgggcaaaccgaaccctgcgctcgcacctcctacacggctgcagtgg
gacattccaaaacagtgccaggcggtcatcgagagttcctaccaggtggccaaggcgttg
gcagacgacgtggagttgtactgcttccagttcctgccctttggcaaaggcctcatcaag
aagtgccggaccagccctgatgcctttgtgcagatcgcgctgcagctggctcacttccgg
gacaggggtaagttctgcctgacctatgaggcctcaatgaccagaatgttccgggaggga
cggactgagactgtgcgttcctgtaccagcgagtccacagcctttgtgcaggccatgatg
gaggggtcccacacgaaagcagacctgcgagatctcttccagaaggctgctaagaagcac
cagaatatgtaccgcctggccatgaccggggcagggatcgacaggcacctcttctgcctt
tacttggtctccaagtacctaggagtcagctctcctttccttgctgaggtgctctcggaa
ccctggcgtctctccaccagccagatcccccaatcccagatccacatgttcgacccagag
cagcaccccaatcacctgggcgctggaggtggctttggccctgtagcagatgatggctat
ggagtttcctacatgattgcaggcgagaacacgatcttcttccacatctccagcaagttc
tcaagctcagagacgaatgcccagcgctttggaaaccacatccgcaaagccctgctggac
attgctgatcttttccaagttcccaaggcctacagctga

DBGET integrated database retrieval system