KEGG   Pan troglodytes (chimpanzee): 470450
Entry
470450            CDS       T01005                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ptr03021]
    470450 (AFF3)
Transcription machinery [BR:ptr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     470450 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 470450
NCBI-ProteinID: XP_024210358
Ensembl: ENSPTRG00000012281
VGNC: 10560
Position
2A
AA seq 1251 aa
MDSFDLALLQEWDLESLWGEDILNQRNDSLVVEFQSSASRCRSVYEPDRNALRRKERERR
NQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQTPVNKIDEHFVADSRAQTQPSSICSTTTSTPAAVPVQQSKRGTMGWQKAGHPP
SDGQQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQN
FPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSSETSVHCTSYRGVPASKPEPA
RAKAKLSKFSIPKQGEETRSGETNSCVEEIIREMTWLPPLSAIQAPGKVEPTKFPFPNKD
SQLVSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTALRALSDS
AVVQQPNCRTSVPSSKGSSSSSSSGSSSSSSDSESSSGSDSETESSSSESEGSKPPHFSS
PEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHGPESNQYYNPVKEDVQDCGKVPDVCQ
PSLREKEIKSTCKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVSAAAPPPAVPCAPAENA
PAPARRSAGKKPTRRTERTSAGDGANCQRPEEPAAADALGTSVVVPQEPTKTRPCGNNRA
SHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQT
VAASASSGNDQRLKEAAANGGNGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLS
PLKDSDEIRSLWVKIDLTLLSRIPEHLPQEPGVLSAPATKDSESAPPSHTSDTPAEKALP
KSKRKRKCDNEDDYREIKKSQGEKDSSSRLATSTSNTLSANHCNMNINSVAIPINKNEKM
LRSPISPLSDASKHKYTSEDLTSSSRPNGNSLFTSASSSKKPKADSQLQPHGGDLTKAAH
NNSENIPLHKSRPQTEPWSPGSNGHRDCKRQKLVFDDMPRSADYFMQEAKRMKHKADAMV
EKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATP
EDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTG
TPSPMSPNPSPASSVGSQGSLSNASALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYW
EMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSAHLS
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcactgtggggtgaa
gacatcttaaaccagaggaatgactctctagttgtggaatttcagtcatcagccagcaga
tgcaggagtgtctatgaaccagatagaaatgcattacggaggaaagaacgagaaagaaga
aatcaagaaactcaacaggatgacggcacgtttaattctagttactctctcttcagtgag
ccctacaagactaacaagggggatgaactctccaaccggatccagaacactttaggcaat
tatgatgaaatgaaagactttttaactgatagatctaatcagagtcatctcgttggagtt
cccaaacctggggttcctcagactcctgtgaacaagatcgatgaacattttgttgcagat
tcaagagcccagacccagccctcgtctatctgtagcactacaacttccacaccagcagct
gtccccgtgcagcagagtaagagaggcactatgggctggcagaaggctgggcacccaccc
tccgatggccaacagagagcaacacaacagggctctctcaggaccttgcttggagatggt
gttggcagacagcagccgcgggccaaacaagtgtgcaatgtggaggtgggccttcagacc
caggagaggccacctgccatggcggccaagcacagcagcagcggacactgtgttcagaac
tttcctccatccctagcttcaaaacccagcctggtccagcagaaaccgaccgcgtatgtg
cggccaatggacggccaagatcaggcccctgatgagtctcctaagctgaagtcgtcttcg
gaaaccagcgtgcactgcacatcatacaggggagtccctgccagcaagccggagcctgcc
agagccaaggccaagctctccaagttcagcatccccaagcagggggaggagactagatct
ggagaaaccaacagctgtgttgaagaaataatccgggagatgacctggcttccaccactt
tctgctattcaagcacctggcaaagtggaaccaaccaaatttccatttccaaataaggac
tctcagcttgtatcctctggacacaataatccaaagaaaggtgatgcagagccagagagt
ccagacaatggcacatcgaatacatcaatgctggaagatgaccttaagctaagcagtgat
gaagaggagaatgaacagcaggcagctcagagaacggctctccgcgctctctctgacagc
gccgtggtccagcagcccaactgcagaacctcggtgccttccagcaagggcagcagcagc
agcagcagcagcggcagcagcagctcctccagcgactcagagagcagctccggatctgac
tcggagaccgagagcagctccagcgagagtgagggcagcaagcccccccacttctccagc
cccgaggctgaaccggcatcctctaacaagtggcagctggataaatggctaaacaaagtt
aatccccacaagcctcctattctgatccaaaatgaaagccacgggccagagagcaatcag
tactacaacccggtgaaagaggacgtccaggactgtgggaaagtccccgacgtttgccag
cccagcctgagagagaaggagatcaagagcacttgcaaggaggagcagaggccaaggaca
gccaacaaggcccctgggagtaaaggcgtgaagcagaagtccccgcccgcggccgtggcc
gtggcggtgagcgcagccgccccgccacccgcagtgccctgtgcgcccgcggagaacgcg
cccgcgcctgcccggaggtccgcgggcaagaagcccaccaggcgcaccgagaggacctca
gccggggacggcgccaactgccagcggcccgaggagcccgcggccgcggacgcgctgggg
acgagcgtggtggtcccccaggagcccaccaaaaccaggccctgtggcaacaacagagcg
agccaccgcaaggagctgcgctcctccgtgacctgcgagaagcgccgcacgcgggggcta
agcaggatcgtccccaaatccaaggagttcattgagacagagtcgtcatcttcgtcctcc
tcctcggactccgacctggagtccgagcaggaggagtaccctctgtccaaagcacagacc
gtggctgcctctgcctcctccgggaatgatcagaggctgaaggaggccgctgccaacggg
ggcaatggtcctagggcccctgtaggctccatcaacgccaggaccaccagtgacatcgcg
aaggagctggaggagcagttctacacactggtcccctttggccggaacgaacttctctcc
cctctaaaggacagtgatgagatcaggtctctctgggtcaaaatcgacctgaccctcctg
tccaggatcccagaacacctgccccaggagccaggggtattgagcgcccctgccaccaag
gactctgagagcgcaccgcccagccacacctcggacacacctgcagaaaaggctttgcca
aaatccaagaggaaacgcaagtgtgacaacgaagacgactacagggagatcaagaagtcc
cagggagagaaagacagctcttcaagactggccacctccaccagtaatactttgtctgca
aaccactgcaacatgaacatcaacagtgtggcaataccaataaataaaaatgaaaaaatg
cttcggtcgcccatctcacccctctccgatgcatctaaacacaaatacaccagcgaggac
ttaacttcttccagccgacctaatggcaacagtttgtttacttcagcctcttccagcaaa
aagcctaaggccgacagccagctgcagcctcacggcggagacctcacgaaagcagctcac
aacaattccgaaaacattcccctccacaagtcacggccgcagacggagccgtggtctcca
ggctccaacggccacagggactgcaagaggcagaaacttgtcttcgatgatatgcctcgc
agtgccgattattttatgcaagaagctaaacgaatgaagcataaagcagatgcaatggtg
gaaaagtttggaaaggctttgaactatgctgaagcagcattgtcgtttatcgagtgtgga
aatgcaatggaacaaggccccatggaatccaaatctccttatacgatgtattcagaaaca
gtagagctcatcaggtatgctatgagactaaaaacccactcaggccccaatgccacacca
gaagacaaacaactggctgcattatgttaccgatgcctggccctcctgtactggcggatg
tttcgactcaaaagggaccacgctgtaaagtattcaaaagcactcatcgactatttcaag
aactcatctaaagccgcccaagccccatctccgtggggggccagtggaaagagcactgga
accccatcccccatgtctcccaacccctctcccgccagctccgtggggtctcagggcagc
ctctccaacgccagcgccctgtccccgtcgaccatcgtcagcatcccacagcgcatccac
cagatggcggccaaccacgtcagcatcaccaacagcatcctgcacagctatgactactgg
gagatggccgacaacctggccaaggaaaaccgagaattcttcaacgacctggatctgctc
atggggccggtcaccctgcacagcagcatggagcacctggtccagtactcccaacagggc
ctgcactggctgcggaacagcgcccacctgtcatag

DBGET integrated database retrieval system