KEGG   Pan troglodytes (chimpanzee): 470464Help
Entry
470464            CDS       T01005                                 

Gene name
UXS1
Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00520  Amino sugar and nucleotide sugar metabolism
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    470464 (UXS1)
Enzymes [BR:ptr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     470464 (UXS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase UXS1_N NAD_binding_4 RmlD_sub_bind 3Beta_HSD Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 470464
NCBI-ProteinID: NP_001267322
Ensembl: ENSPTRG00000012318
VGNC: 10807
UniProt: G2HH95
Position
2A
AA seq 425 aa AA seqDB search
MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMSFLLNRSIQENGELKIESKI
EEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEV
TVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKT
LKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGK
RVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQ
TRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQ
DDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKG
RTRHN
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcaaggcgctgctgcgcctcgtgtctgccgtcaaccgcaggaggatgaagctg
ctgctgggcatcgccttgctggcctacgtcgcctctgtttggggcaacttcgttaatatg
agctttctactcaacaggtctatccaggaaaatggtgaactaaaaattgaaagcaagatt
gaagagatggttgaaccactaagagagaaaatcagagatttagaaaaaagctttacccag
aaatacccaccagtaaagtttttatcagaaaaggatcggaaaagaattttgataacagga
ggcgcagggttcgtgggctcccatctaactgacaaactcatgatggatggccacgaggtg
accgtggtggacaatttcttcacgggcaggaagagaaacgtggagcactggatcggacat
gagaacttcgagttgattaaccacgacgtggtggagcccctctacatcgaggttgaccag
atataccatctggcatctccagcctcccctccaaactacatgtataatcctatcaagaca
ttaaagaccaatacgattgggacattaaacatgttggggctggcaaaacgagtcggtgcc
cgtctgctcctggcctccacatcggaggtgtatggagatcctgaagtccaccctcaaagt
gaggattactggggccacgtgaatccaatagggcctcgggcctgctacgatgaaggcaaa
cgtgttgcagagaccatgtgctatgcctacatgaagcaggaaggcgtggaagtgcgagtg
gccagaatcttcaacacctttgggccacgcatgcacatgaacgatgggcgggtagtcagc
aacttcatcctgcaggcgctccagggggagccactcacggtatacggatccgggtctcag
acaagggcgttccagtacgtcagtgatctagtgaatggcctcgtggctctcatgaacagc
aacgtcagcagcccggtcaacctggggaacccagaagaacacacaatcctagaatttgct
cagttaattaaaaaccttgttggtagcggaagtgaaattcagtttctctccgaagcccag
gatgacccacagaaaagaaaaccagacatcaaaaaagcaaagctgatgctggggtgggag
cccgtggtcccactggaggaaggtttaaacaaagcaattcactacttccgtaaagaactc
gagtaccaggcaaataatcagtacatccccaaaccaaagcctgccagaataaagaaagga
cggactcgccacaactga

DBGET integrated database retrieval system