KEGG   Pan troglodytes (chimpanzee): 470592
Entry
470592            CDS       T01005                                 

Gene name
HNRNPA3
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A3 isoform X1
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03040  Spliceosome
ptr05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    470592 (HNRNPA3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    470592 (HNRNPA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ptr03019]
    470592 (HNRNPA3)
   03041 Spliceosome [BR:ptr03041]
    470592 (HNRNPA3)
Messenger RNA biogenesis [BR:ptr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     470592 (HNRNPA3)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     470592 (HNRNPA3)
Spliceosome [BR:ptr03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    470592 (HNRNPA3)
SSDB
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 PHM7_cyt
Other DBs
NCBI-GeneID: 470592
NCBI-ProteinID: XP_016805575
Ensembl: ENSPTRG00000012676
UniProt: K7DJX6 A0A6D2XGJ1
Position
2B
AA seq 378 aa
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGT
LTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPG
AHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTV
DKIVVQKYHTINGHNCEVKKALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGGGGGNFGRG
GNFGGRGGYGGGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQG
GGYGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPY
GGGYGSGGGSGGYGSRRF
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggaggtaaaaccgccgcccggtcgcccccagcccgactccggccgtcgccgtcgccgc
cggggggaggagggccatgatccaaaggaaccagagcagttgagaaaactgtttattggt
ggtctgagctttgaaactacagatgatagtttaagagaacattttgagaaatggggcaca
ctcacagattgtgtggtgatgagagacccccaaacaaaacgttccaggggctttggtttt
gtgacttattcttgtgttgaagaggtggatgcagcaatgtgtgctcgaccacacaaggtt
gatgggcgtgtagtggaaccaaagagagctgtttctagagaggattctgtaaagcctggt
gcccatctaacagtgaagaaaatttttgttggtggtattaaagaagatacagaagaatat
aatttgagagactactttgaaaagtatggcaagattgaaaccatagaagttatggaagac
aggcagagtggaaaaaagagaggatttgcttttgtaacttttgatgatcatgatacagtt
gataaaattgttgttcagaaataccacactattaatgggcataattgtgaagtgaaaaag
gccctttctaaacaagagatgcagtctgctggatcacagagaggtcgtggaggtggatct
ggcaattttatgggtcgcggagggaactttggaggtggtggaggtaattttggccgtggt
ggaaactttggtggaagaggaggctatggtggtggaggtggtggcagcagaggtagttat
ggaggaggtgatggtggatataatggatttggaggtgatggtggcaactatggcggtggt
cctggttatagtagtagagggggctatggtggtggtggaccaggatatggaaaccaaggt
ggtggatatggtggaggtggaggatatgatggttacaatgaaggaggaaattttggcggt
ggtaactatggtggtggtgggaactataatgattttggaaattatagtggacaacagcaa
tcaaattatggacccatgaaagggggcagttttggtggaagaagctcgggcagtccctat
ggtggtggttatggatctggtggtggaagtggtggatatggtagcagaaggttctaa

DBGET integrated database retrieval system