KEGG   Pan troglodytes (chimpanzee): 470600
Entry
470600            CDS       T01005                                 
Symbol
ZNF804A
Name
(RefSeq) zinc finger protein 804A
Organism
ptr  Pan troglodytes (chimpanzee)
SSDB
Motif
Pfam: zf-C2H2_jaz SF3a60_Prp9_C zf-DBF zf-met
Other DBs
NCBI-GeneID: 470600
NCBI-ProteinID: XP_525981
Ensembl: ENSPTRG00000012712
VGNC: 3885
UniProt: H2QJ40 A0A6D2Y0J9
Position
13:86624803..86964722
AA seq 1208 aa
MECYYIVISSTHLSNGHFRNIKGVFRGPLSKNGNKTLDYAEKENTIAKALEDLKANFYCE
LCDKQYYKHQEFDNHINSYDHAHKQRLKELKQREFARNVASKSRKDERKQEKALQRLHKL
AELRKETVCAPGSGPMFKSTTVTVRENCNEISQRVVVDSVNNQQDFKYTLIHSEENTKDA
TTVAEDPESANNYTAKNNQVGDQAQGIHRHKIGFSFAFPKKASVKLESSAAAFSEYSDDA
SVGKGFSRKSRFVPSACHLQLSSPTDVLLSSEEKTNSFHPPEAMCRDKETVQTQEIKVVS
SEKDALLLPSFCKFQLQLSSDADNCQNSVPLADQIPLESVINEDIPVSGNSSELLGNKST
VLDMSNDCISVQATTEENVKHNEASTTEVENKNGPETLDPSNTEEVNITIHKKTNFCKRQ
CEPFVPVLNKHRSTVLQWPSEMLVYTTTKPSISYSCNPLCFDFKSTKVNNNLDKNKPDLK
DLCSQQKQEDICMGLLSDCKDVSTEGLTDYEIGSSKNKCTQVTPLLANDILSSSCDSGKN
ENTGRRYKNISCKIRETEKYNFTKSQIKQDTLDEKYNKIRLKETHEYWFHKSRRKKKRKK
LCQHHHMEKTKESETRCKMEAENSYTENAGKYLLEPISEKQYLAAEQLLDSHQLLDKRPK
SESVSLSDNEEMCKTWNTEYNTYDTISSKNHCKNNTILLNGQSNATMIHSGKHNLTYSRT
YCCWKTKMSSCSQDHRSLVLQNDMKRMSQNQAVKRGYNSVMNESERFYRKRRQHSHSYSS
DESLNRQNHLPEEFLRPPSTSVAPCKPKKKRRRKRGRFHPGFETLELKENTDYPMKDNSS
LNPLDRLISEDKKEKMKPQEVAKIERNSEQTNQLRNKLSFHPNNLLPSETNGETEHLEME
TTSGELSDVSNDPTTSVCVASAPTKEAIDNTLLEHKERSENINLNEKQIPFQVPNIERNF
RQSQPKSYLCHYELAEALPQGKMNETPTEWLRYNSGILNTQPPLPFREAHVSGHTFVTAE
QILAPLALPEQALLIPLENHDKFKNVPCEVYQHILQPNMLANKVKFTFPPAALPPPSTPL
QPLPLQQSLCSTSVTTIHHTVLQQHAAAAAAAAAAAAAGTFKVLQPHQQFLSQIPALTRT
SLPQLSVGPVGPRLCPGNQPTFVAPPQMPIIPASVLHPSHLAFPSLPHALFPSLLSPHPT
VIPLQPLF
NT seq 3627 nt   +upstreamnt  +downstreamnt
atggagtgttactacattgtcatcagctccacgcatctcagcaacggacactttcgcaac
atcaagggagttttccggggccctctcagcaagaacgggaacaaaactctggactatgct
gagaaggaaaataccatagcaaaagctctggaagatctgaaggcaaatttttactgtgaa
ctctgtgacaagcagtactataagcaccaggagtttgacaatcacattaattcatatgac
cacgctcacaagcagaggctcaaggaactgaaacaaagggaatttgctcgaaatgtagca
tctaaatccaggaaagatgaaagaaaacaggaaaaggcactccaacgcctgcacaagctg
gctgagctaagaaaggaaactgtatgtgctcctggaagtggccccatgttcaaatcaaca
actgttactgtgagagaaaactgtaatgaaatttcccaacgagttgttgtggattcagtt
aataaccagcaagatttcaaatatactttgattcatagtgaagagaatactaaagatgct
accactgttgctgaagatccagaaagtgcaaataattatacagcaaaaaataaccaagtt
ggggatcaagcccaggggattcacagacacaaaatcggcttttcttttgcatttccaaag
aaagcgtccgtgaagctagagtcctcagctgcagccttctctgaatacagtgatgatgcc
tcagtgggaaaaggatttagcagaaaaagtagatttgtccccagtgcttgtcatcttcaa
ctatcttcaccaacagatgtgcttttaagttctgaggagaaaactaactcttttcatcca
ccagaggcaatgtgcagagacaaagaaactgttcaaactcaagagataaaagtagtctct
agtgaaaaagatgcattattattaccttcattttgcaagtttcaacttcagttatcttct
gatgcagataattgtcaaaattcagtcccattagcagatcaaataccactagagagtgtt
attaatgaagacatacctgttagtggtaacagttctgagttgttaggaaataaatccaca
gttcttgacatgtctaatgattgcatatctgtgcaagctaccacagaggaaaatgttaag
cataacgaggcatccacaactgaggttgaaaataaaaatggccccgagacattggatcct
tcaaatactgaagaggttaacataactatacataagaaaacaaatttctgcaaaagacaa
tgtgagccatttgtacctgtccttaacaaacacagatctacagttcttcagtggccatca
gaaatgctggtttatacaactactaaaccatcaatttcctatagctgtaatcctctatgt
tttgacttcaagtctactaaagtaaataataatctagataaaaataagccagacttaaaa
gatctttgttctcagcagaagcaggaagatatttgcatgggactactttcagattgcaag
gatgtatctacagaaggactcactgattatgaaattggaagtagcaaaaataaatgcacc
caagtcactcctcttttggctaatgatattctctccagtagttgtgattctggaaaaaat
gagaacacgggtcggaggtataaaaacatttcctgtaagatcagagaaacagaaaagtat
aattttactaaaagtcaaataaaacaggacactctagatgaaaaatacaacaaaataagg
ttgaaagagactcatgaatactggttccataaaagtagaagaaagaaaaaaagaaaaaag
ttatgtcagcatcatcatatggagaaaaccaaagaatcagaaactcgctgcaaaatggaa
gcagagaatagttacactgaaaatgctgggaaatatctattggaaccaatttcagaaaag
cagtatttagctgcagagcaattattagactcacatcagttacttgataaaaggcccaaa
tcagaatccgtatccttaagtgacaatgaagaaatgtgtaaaacatggaatactgaatac
aacacttatgatactatcagttctaaaaaccactgtaaaaataacacaatacttttaaac
ggacaatcaaatgcaacaatgatacattctgggaaacataatttaacatattctagaact
tactgttgttggaaaaccaaaatgtcaagctgtagtcaggatcacagaagcttagttctt
caaaatgatatgaaacgcatgagtcagaatcaggctgttaaaagaggttacaattctgtc
atgaatgaatcagaaagattctatcgaaaacgtagacaacattcacattcttattcttca
gatgaaagtttaaatcgacagaatcatttaccagaagaatttttgaggccaccaagtact
tcagttgctccctgtaagcctaaaaagaaacggaggcgaaaaagaggcagattccacccc
ggatttgaaactttagaactcaaagaaaatacagattatcccatgaaagacaattcttcc
ttaaatcctctggataggttaataagtgaagacaaaaaagagaaaatgaaaccacaagaa
gttgcaaaaatcgaaaggaactcagaacaaacaaaccaattaagaaacaaactgtctttc
caccctaacaatctccttccttctgaaaccaatggtgaaactgagcatttagaaatggag
accacttctggtgaattgtcagatgtttccaatgatcccaccacatctgtctgtgtagct
agtgccccaacaaaagaagcaattgacaataccctgcttgaacacaaagaaagaagtgag
aatataaatcttaatgaaaagcaaattccttttcaggtgcctaatattgaaaggaacttt
agacagtcacagcctaaatcctatctttgccattatgaactggctgaggcccttccgcaa
ggaaagatgaatgagacaccaactgagtggctgcgttataattcaggaatccttaacaca
caaccaccattaccattcagagaagcacatgtcagtggtcatacttttgtaacagctgag
caaatcctggctccattagctttaccagagcaagcattattgatcccactagaaaaccat
gacaaattcaaaaatgtaccatgtgaggtctaccagcacattcttcagccaaacatgctg
gccaacaaggttaaatttacctttcctccagctgccctcccaccccctagcacacctctg
cagcctttgcctttgcagcagtccttatgttctacctctgtaaccactatccatcacact
gttttgcagcagcacgctgcagctgctgcagctgcagctgcagccgcagctgcaggaacc
tttaaagtgcttcagccacaccaacagtttctttcccaaatcccagctctcaccagaacc
tcattacctcagctctcagtaggaccagtaggaccgaggctttgtcctgggaaccagcca
acttttgttgctcctcctcagatgccaatcattccagcttccgttcttcatcctagccat
ctggctttcccatctttaccccatgcactctttccttcactgctttccccacaccctact
gtcatccctttgcaacctctcttctag

DBGET integrated database retrieval system