KEGG   Pan troglodytes (chimpanzee): 470645Help
Entry
470645            CDS       T01005                                 

Gene name
CXCR1
Definition
(RefSeq) C-X-C chemokine receptor type 1
  KO
K04175  C-X-C chemokine receptor type 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04061  Viral protein interaction with cytokine and cytokine receptor
ptr04062  Chemokine signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    470645 (CXCR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    470645 (CXCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    470645 (CXCR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    470645 (CXCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    470645 (CXCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ptr04030]
    470645 (CXCR1)
   04050 Cytokine receptors [BR:ptr04050]
    470645 (CXCR1)
   04090 CD molecules [BR:ptr04090]
    470645 (CXCR1)
G protein-coupled receptors [BR:ptr04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    470645 (CXCR1)
Cytokine receptors [BR:ptr04050]
 Chemokine receptors
  CXC Chemokine
   470645 (CXCR1)
CD molecules [BR:ptr04090]
 Proteins
  470645 (CXCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 470645
NCBI-ProteinID: NP_001035537
Ensembl: ENSPTRG00000012909
VGNC: 154
UniProt: P55920
Position
2B
AA seq 350 aa AA seqDB search
MSNITDPQMWDFDDLNFTGMPPTDEGYSPCRLETETLNKYVVIITYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatattacagatccacagatgtgggattttgatgatctaaatttcactggcatg
ccacctacagatgaaggttacagcccctgtaggctagaaactgagacactcaacaagtat
gttgtgatcatcacctatgccctagtgttcctgctgagcctgctgggaaactccctggtg
atgctggtcatcttatacagcagggtcggccgctccgtcactgatgtctacctgctgaac
ctggccttggccgacctactctttgccctgaccttgcccatctgggccgcctccaaggtg
aatggctggatttttggcacattcctgtgcaaggtggtctcactcctgaaggaagtcaat
ttctacagtggcatcctgctgttggcctgcatcagtgtggaccgttacctggccattgtc
catgccacacgcacactgacccagaagcgtcacttggtcaagtttgtttgtcttggctgc
tggggactgtctatgaatctgtccctgcccttcttccttttccgccaggcttaccatcca
aacaattccagtccagtttgctatgaggtcctgggaaatgacacagcaaaatggcggatg
gtgttgcggatcctgcctcacacctttggcttcatcgtgccgctgtttgtcatgctgttc
tgctatggattcaccctgcgtacactgtttaaggcccacatggggcagaagcaccgagcc
atgagggtcatctttgctgtcgtcctcatcttcctgctttgctggctgccctacaacctg
gtcctgctggcagacaccctcatgaggacccaggtgatccaggagagctgtgagcgccgc
aacaacatcggccgggccctggatgccactgagattctgggatttctccatagctgcctc
aaccccatcatctacgccttcatcggccaaaattttcgccatggattcctcaagatcctg
gctatgcatggcctggtcagcaaggagttcttggcacgtcatcgtgttacctcctacact
tcttcgtctgtcaatgtctcttccaacctctga

DBGET integrated database retrieval system