KEGG   Pan troglodytes (chimpanzee): 470830Help
Entry
470830            CDS       T01005                                 

Gene name
ABHD6
Definition
(RefSeq) monoacylglycerol lipase ABHD6 isoform X1
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    470830 (ABHD6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptr01002]
    470830 (ABHD6)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     470830 (ABHD6)
Peptidases [BR:ptr01002]
 Serine Peptidases
  Family S33
   470830 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr BAAT_C DUF1057 Thioesterase DUF2048
Motif
Other DBs
NCBI-GeneID: 470830
NCBI-ProteinID: XP_009443993
Ensembl: ENSPTRG00000015056
VGNC: 53352
Position
3
AA seq 338 aa AA seqDB search
MDLDVVNMFVIAGSTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYST
DNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQQVLDVSGADMLAKSIANCQVE
LLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgatgtggttaacatgtttgtgattgcgggcagcacgctggccatcccaatc
ctggcatttgtggcttcatttcttctgtggccttcagcactgataagaatctattattgg
tactggcggaggacattgggcatgcaagtccgctatgttcaccatgaagactatcagttc
tgttattccttccggggcaggcctgggcacaaaccctccatcctcatgctccacggattc
tctgcccacaaggatatgtggctcagtgtggtcaagttccttccaaagaacctgcacttg
gtctgcgtggacatgccaggacatgagggcaccacccgctcctccctggatgacctgtcc
atagatgggcaagttaagaggatacaccagtttgtagaatgcctgaagctgaacaaaaaa
cctttccacctggtaggcacctccatgggtggccaggtggctggggtgtatgctgcttac
tacccatcggatgtctccagcctgtgtctcgtgtgtcctgctggcctgcagtactcaact
gacaatcaatttgtacaacggctcaaagaactgcagggctctgccgccgtggagaagatt
cccttgatcccgtctaccccagaagagatgagtgaaatgcttcagctctgctcctatgtc
cgcttcaaggtgccccagcagatcctgcaaggcctcgtcgatgtccgcatccctcataac
aacttctaccgaaagttgtttttggaaatcgtcagtgagaagtccagatactctctccat
cagaacatggacaagatcaaggttccgacgcagatcatctgggggaaacaagaccagcag
gtgctggatgtgtctggggcagacatgttggccaagtcaattgccaactgccaggtggag
cttctggaaaactgtgggcactcggtagtgatggaaagacccaggaagacagccaagctc
ataatcgactttttagcttctgtgcacaacacagacaacaacaagaagctggactga

DBGET integrated database retrieval system