KEGG   Pan troglodytes (chimpanzee): 471218Help
Entry
471218            CDS       T01005                                 

Gene name
UGT2B7
Definition
(RefSeq) UDP-glucuronosyltransferase 2B7
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00040  Pentose and glucuronate interconversions
ptr00053  Ascorbate and aldarate metabolism
ptr00140  Steroid hormone biosynthesis
ptr00830  Retinol metabolism
ptr00860  Porphyrin and chlorophyll metabolism
ptr00980  Metabolism of xenobiotics by cytochrome P450
ptr00982  Drug metabolism - cytochrome P450
ptr00983  Drug metabolism - other enzymes
ptr01100  Metabolic pathways
ptr05204  Chemical carcinogenesis
Module
ptr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    471218 (UGT2B7)
   00053 Ascorbate and aldarate metabolism
    471218 (UGT2B7)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    471218 (UGT2B7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    471218 (UGT2B7)
   00860 Porphyrin and chlorophyll metabolism
    471218 (UGT2B7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    471218 (UGT2B7)
   00982 Drug metabolism - cytochrome P450
    471218 (UGT2B7)
   00983 Drug metabolism - other enzymes
    471218 (UGT2B7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    471218 (UGT2B7)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     471218 (UGT2B7)
Glycosyltransferases [BR:ptr01003]
 Others
  Hydrophobic molecule
   471218 (UGT2B7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 471218
NCBI-ProteinID: XP_526600
Ensembl: ENSPTRG00000031178
VGNC: 12908
UniProt: H2QPK3
Position
4
AA seq 529 aa AA seqDB search
MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSA
SILFDPNNSSALKIEIYPTSVTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSLFG
DITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTF
EKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVL
GRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSG
ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTM
SSTDLLNALKTVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLACVAAVIFIVTKCCLFCFWKFARKAKKGKND
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcagtaattttgctaatacaactgagcttttgctttagctct
gggaattgtggaaaggtgctggtgtgggcagcagaatatagccattggatgaatataaag
acaatcctggatgagcttattcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaaatttatcccacatct
gtaactaaaactgagttggagaatttcatcatgcaacagattaagagatggtcagacctt
ccaaaagacacattttggttatatttttcacaagtacaggaaatcatgtcactatttggt
gacataactagaaagttctgtaaagatgtagtttcaaataagaaatttatgaaaaaagta
caagagtcaagatttgatgtcatttttgcagatgctatttttccctgtagtgagctgctg
gctgagctatttaacataccctttgtgtacagtctcagcttctctcctggctacactttt
gaaaagcatagtggaggatttattttccctccttcctatgtacctgttgttatgtcagaa
ttaactgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttacttt
gacttttggttcgaaatatttgacatgaagaagtgggatcagttttatagtgaagttcta
ggaagacccactacattatctgagacaatggggaaagctgacgtatggcttattcgaaac
tcctggaattttcagtttccatatccactcttaccaaatgttgattttgttggaggactc
cactgcaaacctgccaaacccctgcctaaggaaatggaagactttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcaatggtcagtaacatgacagaagaaagg
gccaacgtaattgcatcagcccttgcccagatcccacaaaaggttctgtggagatttgat
gggaataaaccagataccttaggtctcaatactcggctctacaagtggataccccagaat
gaccttctaggtcatccaaagaccagagcttttataactcatggtggagccaatggcatc
tacgaggcaatctaccatgggatccctatggtggggattccattgtttgccgatcaacct
gataacattgctcacatgaaggccaggggagcagctgttagagtggacttcaacacaatg
tcgagtacagacttgctgaatgcattgaagacagtaattaatgatccttcatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggacgtgattgggttcctgctggcctgt
gtggcagctgtgatatttatcgtcacaaaatgttgtctgttttgtttctggaagtttgct
agaaaagcaaagaagggaaaaaatgattag

DBGET integrated database retrieval system