KEGG   Pan troglodytes (chimpanzee): 471835
Entry
471835            CDS       T01005                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X2
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptr01002]
    471835 (ERAP1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     471835 (ERAP1)
Peptidases and inhibitors [BR:ptr01002]
 Metallo peptidases
  Family M1
   471835 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1570
Other DBs
NCBI-GeneID: 471835
NCBI-ProteinID: XP_003310814
Ensembl: ENSPTRG00000017095
VGNC: 3978
UniProt: H2QR94
Position
5
AA seq 948 aa
MVFLPLKWSLATMSFLLSSLLALLTVSTPSWCQSTEASPKRSDGTPFPWNKIRLPEYVIP
VHYDLLIHANLTTLTFWGTTKVEITASQPTSTIILHSHHLQISRATLRKGAGERLSEEPL
QVLEHPPQEQIALLAPEPLLVGLPYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILAST
QFEPTAARMAFPCFDEPAFKASFSIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTV
KMSTYLVAFIISDFESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVAHELAHQWF
GNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVGDYFFGKCFDAMEVDALNSSHPVS
TPVENPAQIREMFDDVSYDKGACILNMLREYLSADAFKSGIVQYLQKHSYKNTKNEDLWD
SMASICPTDGVKGMDGFCSRSQHSSSSSHWHQEGLDVKTMMNTWTLQKGFPLITITVRGR
NVHMKQEHYMKGSDGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKF
NLGMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDL
SLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEG
SVSERMLRSQLLLLACVHNYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTE
GWDFLYSKYQFSLSSTEKSQIEFALCRTQNKEKLQWLLDESFKGDKIKTQEFPQILTLIG
RNAVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKE
NGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLEHDPEADATG
NT seq 2847 nt   +upstreamnt  +downstreamnt
atggtgtttctgcccctcaaatggtcccttgcaaccatgtcatttctactttcctcactg
ttggctctcttaactgtgtccactccttcatggtgtcagagcactgaagcatctccaaaa
cgtagtgatgggacaccatttccttggaataaaatacgacttcctgagtacgtcatccca
gttcattatgatctcttgatccatgcaaaccttaccacgctgaccttctggggaaccacg
aaagtagaaatcacagccagtcagcccaccagcaccatcatcctgcatagtcaccacctg
cagatatctagggccaccctcaggaagggagctggagagaggctatcagaagaacccctg
caggtcctggaacacccccctcaggagcaaattgcactgctggctcccgagcccctcctt
gtcgggctcccgtacacagttgtcattcactatgctggcaatctttcggagactttccac
ggattttacaaaagcacctacagaaccaaggaaggggaactgaggatactagcatcaaca
caatttgaacccactgcagctagaatggcctttccctgctttgatgaacctgccttcaaa
gcaagtttctcaatcaaaattagaagagagccaaggcacctagccatctccaatatgcca
ttggtgaaatctgtgactgttgctgaaggactcatagaagaccattttgatgtcactgtg
aagatgagcacctatctggtggccttcattatttcagattttgagtctgtcagcaagata
accaagagtggagtcaaggtttctgtttatgctgtgccagacaagataaatcaagcagat
tatgcactggatgctgcggtgactcttctagaattttatgaggattatttcagcatacca
tatcccctacccaaacaagatcttgctgctattcccgactttcagtctggtgctatggaa
aactggggactgacaacatatagagaatctgctctgttgtttgatgcagaaaagtcttct
gcatcaagtaagcttggcatcacaatgactgtggcccatgaactggcccaccagtggttt
gggaacctggtcactatggaatggtggaatgatctttggctaaatgaaggatttgccaaa
tttatggagtttgtgtctgtcagtgtgacccatcctgaactgaaagttggagattatttc
tttggcaaatgttttgacgcaatggaggtagatgctttaaattcctcacaccctgtgtct
acacctgtggaaaatcctgctcagatccgggagatgtttgatgatgtttcttatgataag
ggagcttgtattctgaatatgctaagggagtatcttagtgctgacgcatttaaaagtggt
attgtacagtatctccagaagcatagctataaaaatacaaaaaacgaggacctgtgggat
agtatggcaagtatttgccctacagatggtgtaaaagggatggatggcttttgctctaga
agtcaacattcatcttcatcctcacattggcatcaggaagggctggatgtgaaaaccatg
atgaacacttggacactgcagaagggttttcccctaataaccatcacagtgagggggagg
aatgtacacatgaagcaagagcactacatgaagggctctgacggcgccccggacactggg
tacctgtggcatgttccattgacattcatcaccagcaaatccgacatggtccatcgattt
ttgctaaaaacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaattt
aatctgggcatgaatggctattacattgtgcattacgaggatgatggatgggactctttg
actggccttttaaaaggaacacacacagcagtcagcagtaatgatcgggcgagtctcatt
aacaatgcatttcagctcgtcagcattgggaagctgtccattgaaaaggccttggattta
tccctgtacttgaaacatgaaactgaaattatgcccgtgtttcaaggtttgaatgagctg
attcctatgtataagttaatggagaaaagagatatgaatgaagtagaaactcaattcaag
gccttcctcatcaggctgctaagggacctcattgataagcagacatggacagatgagggc
tcagtctcagagcgaatgctgcggagtcaactactactcctcgcctgtgtgcacaactat
cagccgtgcgtacagagggcagaaggctatttcagaaagtggaaggaatccaatggaaac
ttgagcctgcctgtcgacgtgaccttggcagtgtttgctgtgggggcccagagcacagaa
ggctgggattttctttatagtaaatatcagttttctttgtccagtactgagaaaagccaa
attgaatttgccctctgcagaacccaaaataaggagaagcttcaatggctactagatgaa
agctttaagggagataaaataaaaactcaggagtttccacaaattcttacactcattggc
aggaacgcagtaggatacccattggcctggcaatttctgaggaaaaactggaacaaactt
gtacaaaagtttgaacttggctcatcttccatagcccacatggtaatgggtacaacaaat
caattctccacaagaacacggcttgaagaggtaaaaggattcttcagctctttgaaagaa
aatggttctcagctccgttgtgtccaacagacaattgaaaccattgaagaaaacatcggt
tggatggataagaattttgataaaatcagagtgtggctgcaaagtgaaaagcttgaacat
gatcctgaagctgacgcaacaggatga

DBGET integrated database retrieval system