KEGG   Pan troglodytes (chimpanzee): 472014Help
Entry
472014            CDS       T01005                                 

Gene name
XPO5
Definition
(RefSeq) exportin-5
  KO
K14289  exportin-5
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    472014 (XPO5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ptr03016]
    472014 (XPO5)
   03036 Chromosome and associated proteins [BR:ptr03036]
    472014 (XPO5)
Transfer RNA biogenesis [BR:ptr03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    472014 (XPO5)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     472014 (XPO5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 472014
NCBI-ProteinID: XP_009449601
Ensembl: ENSPTRG00000018204
VGNC: 3790
UniProt: H2QT28
Position
6
AA seq 1204 aa AA seqDB search
MAMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEKCPICVPCGLRLAEKTQI
AIVRHFGLQILEHVVKFRWNGMSRLEKVYLKNSVMELIANGTLNILEEENHIKDALSRIV
VEMIKREWPQHWPDMLIELDTLSKQGETQTELVMFILLRLAEDVVTFQTLPPQRRRDIQQ
TLTQNMERIFSFLLNTLQENVNKYQQVKTDTSQESKAQANCRVGVAALNTLAGYIDWVSM
SHITAENCKLLEILCLLLNEQELQLGAAECLLIAVSRKGKLEDRKPLMVLFGDVAMHYIL
SAAQTADGGGLVEKHYVFLKRLCQVLCALGNQLCALLGADSDVETPSNFGKYLESFLAFT
THPSQFLRSSTQMTWGALFRHEILSRDPLLLAIIPKYLRASMTNLVKMGFPSKTDSPSCE
YSRFDFDSDEDFNAFFNSSRAQQGEVMRLACRLDPKTSFQMAGEWLKYQLSTFLDAGSVN
SCSAVGTGEGSLCSVFSPSFVQWEAMTLFLESVITQMFRTLDREEIPVNDGIELLQMVLN
FDTKDPLILSCVLTNVSALFPFVTYRPEFLPQVFSKLFSSVTFETVEESKAPRTRAVRNV
RRHACSSIIKMCRDYPQLVLPNFDMLYNHVKQLLSNELLLTQMEKCALMEALVLISNQFK
NYERQKVFLEELMAPVASIWLSQDMHRVLSDVDAFIAYVGTDQKSCDPGLEDPCGLNRAR
MSFCVYSILGVVKRTCWPTDLEEAKAGGFVVGYTSSGNPIFRNPCTEQILKLLDNLLALI
RTHNTLYAPEMLAKMAEPFTKALDMLDAEKSAILGLPQPLLELNDSPVFKTVLERMQRFF
STLYENCFHILGKAGPSMQQDFYTVEDLATQLLSSAFVNLNNIPDYRLRPMLRVFVKPLV
LFCPPEHYEALVSPILGPLFTYLHMRLSQKWQVINQRSLLCEEDEAADENPESQEMLEEQ
LVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMK
HEDVCTALLITAFNSLAWKDTLSCQRTTSQLCWPLLKQVLSGTLLADAVTWLFTSVLKGL
QMHGQHDGCMASLVHLAFQIYEALRPRYLEIRAVMEQIPEIQKDSLDQFDCKLLNPSLQK
VADKRRKDQFKRLIAGCIGKPLGEQFRKEVHIKNLPSLFKKTKPMLETEVLDNDGGGLAT
IFEP
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggatcaagtaaatgcgctgtgcgagcagctggtgaaagcggtgacggtcatg
atggaccccaactccacccagcgctaccggctggaagccctcaagttttgtgaagagttt
aaagaaaagtgtcctatctgtgtaccctgtggcttgaggttggctgagaaaacacaaatt
gccatcgtcagacattttggccttcagatcctggaacacgttgtcaagtttcggtggaac
ggcatgtctcgattggagaaggtgtatctgaagaacagtgtcatggagctgattgcaaat
ggaacattgaacattttggaagaggagaaccatattaaagatgctctgtctcgaattgta
gtggaaatgatcaagcgagagtggccacagcattggcctgacatgctaatagaattggac
actctttccaaacaaggggaaacacagacagaattggtgatgtttatccttttgcgactg
gcagaggatgtagtgacttttcagacacttccccctcaaagaagaagggacatccagcaa
acattaacccagaacatggaaaggatcttcagttttctgcttaacacacttcaagaaaat
gtaaacaagtatcagcaagtgaagacagatacttctcaggagtcaaaggcgcaagcaaac
tgtcgagtaggagttgcagcactgaatactctagcaggctatattgactgggtgtctatg
agtcacatcactgctgaaaactgtaaactcctggagatactgtgtttgctgttgaatgaa
caggaacttcagttgggagccgctgagtgtcttctcattgcagtcagcagaaaaggcaag
ttggaagaccggaagcccttgatggtcttatttggagatgttgccatgcattatatactc
tccgccgcacagactgctgatggaggaggtttggtagaaaaacactacgtctttctgaag
aggctctgtcaggtgttgtgtgcgctgggcaatcagctgtgtgcattgctgggtgcagat
tctgatgtagaaacaccatcaaactttggaaaatacctggaatcttttcttgctttcaca
acccatccaagtcagtttctacgctcttcaactcagatgacttggggagccctcttcagg
catgaaatcctgtcccgtgatcctttgctattagcaataataccaaaatatcttcgtgct
tccatgactaacttggtcaagatgggctttccttctaaaacagacagccctagctgtgaa
tattctcggtttgattttgatagcgatgaggacttcaatgctttcttcaactcctctcga
gcgcaacaaggagaggtgatgaggttggcatgtcgtttggatcccaaaactagcttccag
atggctggggagtggctaaagtatcaactatcaacttttcttgatgctggttctgtgaat
tcttgttctgcagttggaactggagaaggaagcctctgttccgtcttctcaccttcattc
gtgcagtgggaagccatgactctttttttggaaagtgttatcacccagatgtttcgaaca
ctagatagagaagaaattcctgttaatgatggaatagagctattgcagatggttctgaac
tttgataccaaggatcccctcatcctgtcctgcgtccttactaatgtctctgcactcttt
ccatttgtcacctacagaccagagttcctgccccaggtcttctctaagctattttcatct
gtcacttttgaaactgttgaagaaagtaaggcccccagaacccgggcagtgaggaatgtg
aggaggcatgcttgttcctccatcatcaagatgtgtcgtgactacccccagcttgtgctg
cccaattttgacatgctttataaccatgtgaagcaactcctctccaatgagctactcctg
acacaaatggagaagtgtgccctcatggaagccctggttctcattagcaaccaatttaag
aactacgagcgtcagaaggtgttcctagaggagctgatggcaccagtggccagcatctgg
ctttctcaagacatgcacagagtgctgtcagatgttgatgctttcattgcgtatgtgggt
acagatcagaagagctgtgacccaggcctggaggatccgtgtggcttaaaccgtgcacga
atgagcttttgtgtatacagcattctgggtgttgtgaaacgaacttgctggcccactgac
ctagaagaggccaaagctgggggatttgtggtgggttatacatccagtggaaatccaatc
ttccgtaacccctgcacagagcagattctgaaacttcttgacaatttgcttgcgcttata
agaacccacaatacattatatgcaccagaaatgctagccaaaatggcagagcctttcacc
aaggctctggatatgcttgacgcggaaaaatctgctatattaggattacctcaacctctc
ttggaactcaatgactctcctgtcttcaaaaccgtcttggaaagaatgcagcgtttcttc
tccaccctctatgaaaactgttttcatatcctagggaaggcaggcccttccatgcagcaa
gacttctatactgtggaggaccttgctacccagcttctcagctcagcctttgtcaacttg
aacaatattcctgactaccgactcagacccatgcttcgggtctttgtaaagcctctggtg
ctcttctgtcccccagagcactatgaagccctggtatcccccatcctcggacctcttttc
acctacctccatatgaggctttctcagaaatggcaagttatcaaccaaaggagcctgctg
tgtgaagaagatgaggctgcagatgaaaacccagagtctcaagagatgctggaggagcaa
ctggtgaggatgttaacccgagaagtcatggacctaatcacggtttgctgtgtttcaaag
aagggtgctgaccacagtagtgctcccccagcagatggagacgatgaagaaatgatggcc
acagaggtcaccccctcagctatggcagagcttacagacctgggcaaatgtctgatgaag
catgaggatgtttgtacagcgctattaattacagccttcaattccctggcctggaaagat
actctgtcctgccagaggacaacctcacagctctgctggcctctcctcaaacaagtgctg
tcagggacactgctcgcagatgcagttacgtggcttttcaccagtgtgctgaaaggctta
cagatgcatgggcagcacgacgggtgcatggcttccctggtccatctggccttccagata
tacgaggcactgcgccccaggtacctggagataagagctgtaatggagcaaatccctgaa
atacagaaggactcactggaccagtttgactgcaagcttttaaacccctccctgcagaaa
gtggctgacaagcgccgaaaggaccaattcaaacgcctcattgctggttgcattgggaaa
cccttgggagagcagttccgaaaagaagttcacatcaagaatcttccctcacttttcaaa
aaaacaaagccaatgctggagacggaggtgctggacaatgatgggggtggcctggccacc
atctttgaaccctga

DBGET integrated database retrieval system